Conserved Protein Domain Family
PHA01633

?
PHA01633: PHA01633 
putative glycosyl transferase group 1
Statistics
?
PSSM-Id: 107050
View PSSM: PHA01633
Aligned: 3 rows
Threshold Bit Score: 645.496
Threshold Setting Gi: 159341081
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122301    1 MKTAILTMNYSSISNVSEDIAEVLrenGEIATITKNPFYIPKA---EKLIVFIPFHPPSLNPYLYAYYQFQGKKYFYTTC 77
gi 159341081   1 MKTLVLTMNYSSIRNVAEDISETI---GNAVVDITPELYINTTqhfERLIVFVPFIPPMLNNYLLVYNMFKGPKYFYTTA 77
gi 22122248    1 MKTAILTMNYSSISNVSEDIAEVLrenGEIVTITKNPFYIPKA---EKLIVFIPFHPPSLNPYLYAFYQFNGKKLFYTTC 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122301   78 DGIPNIEIVNKYLLQDVKFIPNSKFSAINLQEVGLQVDLPVFHGINFKIVENAEKLVPQLKEKLNKDFPGSIKFGIVSGL 157
gi 159341081  78 DGVPSTDIINRHLLRDVTFIPNSNFTAENLSTAGLSVDIPVFHGINFKIVEKAKSLVPKLKQKLDNDFPDTIKFGVVTGM 157
gi 22122248   78 DGIPNIEIVNKYLLQDVKFIPNSKFSAMNLQEVGLQTDLPVFHGINFKIVENAEKLVPQLKQKLDKDFPNTIKFGIVSGL 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122301  158 TKRKNMDLMLQVFNELNTKYPDIAKKIHFFIISHKQFTQYEVPANVHFVAEFGWNSREYIFAFYGAMDFVIVPSGTEGFG 237
gi 159341081 158 TKRKNIDLFVQTTKLLNEKFPDPAKRIHFFVISHEDFKKLEVPANVHFVAAFGHQPRENVLAFYGAMDFTFMPTGCEGFG 237
gi 22122248  158 TKRKNMDLMLQVFNELNTKYPDIAKKIHFFVISHKQFTQNEVPANVHFVAEFGFNSREYIFGFYGAMDYIIVPSGTEGFG 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122301  238 MPVLESMSMGTPVIHQLMPPLDEFTSWQWNLLIKSSKVEEYYDREHGQKWKIHKFDIEDMLNAIILATELEDREERSEKL 317
gi 159341081 238 LPLLESMAMGTPVIHQAIPPLTEFTSWQWNYLFRYNTVENYADKDHAQSWKIYRFQPEDAAAAILTAFLSQDREERSMHL 317
gi 22122248  238 MPVLESMAMGTPVIHQLMPPFDEFTSWQWNLLIKSSKVEEYYDKEHGQKWKIHKFEIEDMINAIILASELQDREERSTKL 317
                        330
                 ....*....|....*...
gi 22122301  318 KELAKKYDIRNLYTRFLE 335
gi 159341081 318 MELAKKYDVSFLYKRFLE 335
gi 22122248  318 KELAKRYDIRNLYTRFLE 335
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap