Conserved Protein Domain Family
PHA01634

?
PHA01634: PHA01634 
hypothetical protein
Statistics
?
PSSM-Id: 133954
View PSSM: PHA01634
Aligned: 9 rows
Threshold Bit Score: 248.998
Threshold Setting Gi: 22122314
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122260    1 MNFDDYFCKLQCCYWREFEFAYSKLDVKDKTITIIGNDCGSSALYFLLKGAKKIIGFEKEEKLNQIFKEtVCKEFKICDK 80
gi 159341092   1 MDIENYFRNLECDYWREYPRSYGLLNVYQRTVQIVGADCGSSALYFLLRGASSVVQYEKEEKLRKKWQQ-VCADFSICDK 79
gi 22122314    1 MNYDDYFCKLQCCYWREFDFAYSRLDVKDKTITIIGNDCGSSALYFLLKGAKKIIGFEKEEKLNQIFKEtVCKEFKICDK 80
gi 16753150    2 ISIADYFRQKDCDYWREYPHSYGKLDVFGKTIQIVGADCGSSALYFLMRGAKYIIQYEKEEHLRKRWEE-ACKYFNICDK 80
gi 162329348   2 ESIEEYFKKRECDYWREYPHSYGMLNVYQRSIQIVGADCGSSALYFLLRGASFVVQYEKEEHLRKKWEE-VCAYFNICNK 80
gi 162329418   2 ESIEEYFKKRECDYWREYPHAYGMLNVYQRSIQIVGADCGSTALYFLLRGASFVVQYEKEEHLRKKWEE-VCAYFNICNK 80
gi 162329477   1 --MEEYFRKRECDYWREYPHEYGMLDVYRRSIQIVGADCGSSALYFLLRGASFVVQYEKEEKLRKKWEE-VCSYFNICDK 77
gi 162329538   2 ESIEEYFKKRDCDYWREYPHAYGMLNVYQRSIQIVGADCGSTALYFLLRGASFVVQYEKEEHLRKKWEE-VCAYFNICNK 80
gi 171473709   1 MNIEEYFRQKECDYWREYPHSYGLLNVFNKTIQIVGADCGSSALYFLLRGAKYIIQYEKEEHLRKKWNE-VCQYFNICDK 79
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 22122260   81 VESKGEWKSnEYPDTDILVMDCEGCEKNLDFSKLQKYKQYCIAIHDWTENRFDLLRKLYGTILTFVTDDNREFVFCKL 158
gi 159341092  80 AVMKEEWNG-EYEDTNIFIMDCEGCEEKLNVSQLNKYSQWCIGVHDWAKNRVELLRKLEGATFTYASDDGREITLCRI 156
gi 22122314   81 VEIKGKWKGnEYPDTDILVMDCEGCEKNLDFSKLQKYKQYCIAIHDWTENRFDLMRKLYGSILTFVSDDNREFVFCKL 158
gi 16753150   81 AMMKNEWNG-EYENADIFVIDCEGCEEHLNVDILKKYEQWCVGIHDWTKNRVELMRKMEGTIFTYVSDDGREMTLCKT 157
gi 162329348  81 AVMKGEWDG-VYENVDIFVMDCEGCEEKLNVNMLTRYKQWCVGIHDWTKNRVELMRKMEGATFTYVSDDGREITLCKI 157
gi 162329418  81 AVMKGEWDG-VYENVDIFVMDCEGCEEKLNVNMLTRYKQWCVGIHDWTKNRVELLRKMEGATFTYVSDDGREITLCKI 157
gi 162329477  78 AEMKEEWNG-QYDDVDIFVMDCEGCEEKLDVSQLKKYKQWCVAIHDWTHNRVELLRKMEGMTFTYVSDDGKEIVLCKI 154
gi 162329538  81 AVMKGEWDG-VYENVDIFVMDCEGCEEKLNVNMLTRYKQWCVGIHDWTKNRVELMRKMKGATFTYVSDDGKEITLCKI 157
gi 171473709  80 ATMKKEWNG-EYENVDVFVMDCEGCEEQLNVDMLKKYEQWCIGIHDWTKNRVELMRKMEGTIFTYVSDDGREITLCKT 156
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap