Conserved Protein Domain Family
dut

?
PHA01707: dut 
2'-deoxyuridine 5'-triphosphatase
Statistics
?
PSSM-Id: 107053
View PSSM: PHA01707
Aligned: 3 rows
Threshold Bit Score: 295.692
Threshold Setting Gi: 51980159
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
51980159   1 MIFSDRDLKYYLEKGWIKIEPLREDTIRENGVDLRIGNEIVRFKKNrifdpdkdsiddfIEKEVGNEFIINPHEHVLLVT 80 
22122296   1 MILSDRDIKRYINLNRLVIDPLSEDTIRENGVDLKIGNEIIRIKEE-------------MKKEVKDEFIIYPYEHVLLTT 67 
22122244   1 MILSDRDIKTYINSKKLVINPLSEDTIRENGVDLKIGNEIVRIKEN-------------MEKEVGDEFIIYPNEHVLLTT 67 
51980159  81 EEYVKLPNDVMAFVNLRSTFARLGLFIPPTIVDAGFEGQLTIELVGSEFPIKLKYGMRFIHLIFAKTLTPVEKPYNGKYQ 160
22122296  68 KEYIKLPNDIIAFCNLRSTFARKGLLIPPTIVDAGFEGQLTIELVGSSIPVKLKSGERFLHLIFARTITPVERPYHGKYQ 147
22122244  68 KEYIKLSNDIIAFCNLRSTFARKGLLIPPTIVDAGFEGQLTIELVGSSIPVKLKSGERFLHLIFARTLTPVEKPYNGKYQ 147
51980159 161 KQRGVTPAKLL 171
22122296 148 NQKGVTLAKED 158
22122244 148 KQKGVTLAKED 158
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap