Conserved Protein Domain Family
PHA01733

?
PHA01733: PHA01733 
hypothetical protein
Statistics
?
PSSM-Id: 107055
View PSSM: PHA01733
Aligned: 3 rows
Threshold Bit Score: 267.141
Threshold Setting Gi: 61806432
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148724485   1 MKPYYRPATSRDAVLVANNLRKEDRMEI-EGLGQHPLVLPFCVLSSDAPVAFFNSEGELAGVAGIMPDerehvGQVWMIC 79
gi 61806432    1 MSKFIHPVTKEAALDVASNLLPDDRREVeEGHGHDPVKVIPLCAAYGDSVYFTVPNGDLAGVAGVQED-----GRIWMLC 75
gi 18640501    3 QSDNNRPATQADITELIQNIRQEDREEI-EGLGHSVLALHLSLDVSENVTAMVAPDGSIAGVAGLV-DmgnrvGEIWMVC 80
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 148724485  80 TPAVQKNPHHLVRQAKKWLDe-QRNYRLLWNLADARNLFHQKLLRLLGFKAIAAQPAGPYGLPFLEIVKLCASPQ 153
gi 61806432   76 TPAIHKYPLTFAREAKRYVE--SREEKLLWNIVDKRNRVHIKLLRFLGFKFLRELKHGPNQLPFMEFCRVFRSGC 148
gi 18640501   81 TKAIERNPIALLKGAKWWLPkvSKNYDILYNIVSKDNLVHRRLLKKLGFRGLRYVQPAPLYKPYIEFVKKCASS- 154
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap