Conserved Protein Domain Family
PHA01746

?
PHA01746: PHA01746 
hypothetical protein
Statistics
?
PSSM-Id: 107059
View PSSM: PHA01746
Aligned: 3 rows
Threshold Bit Score: 171.654
Threshold Setting Gi: 159341070
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22122290    1 MASLKQIIDELTSQAKENNKIASRILKIKGIKRIVVQLNAVPqDGKIrySMTIHSQNNFRKQIGITPQDAQDLKLIAEFL 80 
159341070   1 MSDLEDIILNLKDKAKDSGHYVSKIINIKGLQRLTLQINASP-DGHV--SMTVHSKSNFKKQIGVTASDAGDLMLISKFL 77 
22122237    1 MASLKEIIDELGKQAKEQNKIASRILKIKGIKRIVVQLNAVPqDGKIrySLTIHSQNNFRKQIGITPQDAEDLKLIAEFL 80 
22122290   81 EKYADFLNEYVKFTP------RNNNAIQEEELDMEQQEEKEEKTREKGRKKTVEEEF 131
159341070  78 TKYSGTLDKYVKFSKltvrnnDDENVVDIDDDNNDQKPQQKEKGKHKERPKNIEDEF 134
22122237   81 EKYSDFLNEYVKFTP------RNNNAIQEEEIDMEQQEEKEEKPREKGKKKSVEEEF 131
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap