Conserved Protein Domain Family
PHA01754

?
PHA01754: PHA01754 
hypothetical protein
Statistics
?
PSSM-Id: 133959
View PSSM: PHA01754
Aligned: 3 rows
Threshold Bit Score: 86.3865
Threshold Setting Gi: 159341077
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 22122309   1 MSEQKRRSNLNTELTAKLYLALDDLTMALATEDKEEVRKSEVFQKALEVVKVVKEMRRLQVKPVEGEEK 69
gi 22122255   6 MSEQKKKSNLNTELTAKLYLALDDLTMALATEDKEEVRKSEVFQKALEVVKVVKEMRRLQVKPAEGEEK 74
gi 159341077 12 KSEKEKIPALDQEFSAKLFVALNDLAMALATCESEEVRKSEVYQTAQEVIKVLKSIKR------KSEKS 74
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap