Conserved Protein Domain Family
PHA01756

?
PHA01756: PHA01756 
hypothetical protein
Statistics
?
PSSM-Id: 107069
View PSSM: PHA01756
Aligned: 3 rows
Threshold Bit Score: 413.984
Threshold Setting Gi: 159341078
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122261    1 MSVTYTSISSLLASPFQRLTSSMWNTATLLLYQLYETGGNSLTSILQNGNLYIPNNISALAGFFQKEVYVSGQPVLTEQD 80
gi 22122315    1 MSVTYTSISSLLASPFQRLTSSMWNTSVLLLYQLYETGGNTVSQILQNGNLYIPNNISALSGFFQKEVYVSGQPVLTEQD 80
gi 159341078   9 MSITYASISDLLAKPFQRLTSSMWNAVVLELNQVYFGGSLIDRKLFVDNNLYVPQNLFAMTGDFYNEVYVAGQPVLTEQD 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122261   81 PIYIAGFIGTANQQINQILYSNQQLYYSISQLPK---EISYDLYTNLYRTISDLTSTLSSQISQLQKTGI---------- 147
gi 22122315   81 PIYIAGFIGTANQQINQVLYSNQQLYYSISKLPK---EISYDLYINLYRTISGLTSSLSSQIAQLQKTGI---------- 147
gi 159341078  89 PIYIAGFISTAYNQISAILASQQQLYTAISNIPHslgNIAYPLDV-LYRNLQSIQSGFYGILQQFLYQTAqnfnvflgel 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122261  148 -------------------------------NALYSIADFLAYTFTYFYLATVGLANTLNKLTLFLSPPTIEGLQISLST 196
gi 22122315  148 -------------------------------NALYSIADFLAYTFTYFYLATVGLVNTLNKLTLFLSPPTIEGLQISLST 196
gi 159341078 168 yklsespvfnewytlyntnailqqalnvylpKTLTTLADTVIYDLFYMYLATATLANAINKLTVYLSPSSVQGLSISVGQ 247
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 22122261  197 IPSPIYNGSTIETVRIILQNLSNYIVYIGNKLYNSFPILPGDSLEFHVRNPSNVYAWATGKCTVYALFEVVQ 268
gi 22122315  197 VPSPLYSSSTLETVRIILQNLSNYIVYIGNQLYNSFPILPGDSLEFHVRNPSNVYAWATGKCTVYALFEVVQ 268
gi 159341078 248 SPAPIYSGPALQTVKIILQNLSNYIIYIGNSIYNNFPILPNNNVEFRISNPANVYAWSTGPATVYALFEVT- 318
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap