Conserved Protein Domain Family
PHA01809

?
PHA01809: PHA01809 
hypothetical protein
Statistics
?
PSSM-Id: 107079
View PSSM: PHA01809
Aligned: 3 rows
Threshold Bit Score: 103.579
Threshold Setting Gi: 29565744
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60
               ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 29565744  1 MENETKNIELKHVFRFKNGSLCIALFDRTENEISFYDVDIDEIEDLNHNSVLRVISTLLGSDNNG 65
gi 29565722  1 MENETKNIELKHVFRFKNGSLCIALFDRTENEISFYDVDIDEIEDLNHNSVLRVISTLLGSDNNG 65
gi 66395206  1 MENETKNIELKHVFRFKNGSLCIALFDTTENEISFYDVDIDEIEDLNHNSVLRVISTLLGSDNNG 65
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap