Conserved Protein Domain Family
PHA01813

?
PHA01813: PHA01813 
hypothetical protein
Statistics
?
PSSM-Id: 107083
View PSSM: PHA01813
Aligned: 4 rows
Threshold Bit Score: 65.3308
Threshold Setting Gi: 157738591
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*....
gi 157738591  1 MEKIYTAVLLYNVSINETYEHEIEQFEKINKVKVIYSYFDANFYKKgAYNFGVKYIKEI 59
gi 66395208   1 MERKYKTVLLYCDEIKGHLPHQIAMFEDLYDAKVVYSYYEYNLFTK-KYAYIIEYIKEI 58
gi 29565748   1 MERKYKTVLLYCDEIKGHFPHQISMFEDLYDAKVVYSYYEYNLFTK-KYAYIIEYIKEI 58
gi 29565726   1 MERKYKTVLLYCDEIKGHFPHQISMFEDLYDAKVVYSYYEYNLFTK-KYAYIIEYIKEI 58
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap