Conserved Protein Domain Family
PHA01818

?
PHA01818: PHA01818 
hypothetical protein
Statistics
?
PSSM-Id: 107088
View PSSM: PHA01818
Aligned: 3 rows
Threshold Bit Score: 694.129
Threshold Setting Gi: 66391272
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66394966   1 MALNFTTITENNVIRDLTTQVNNIGEELTKERNIFDITDDLVYNFNKSQKIKLTDDKGLTKSYGNITALRDIKEPGYYYI 80
gi 48696456   1 MALNFTTITENNVIRDLTTQVNNIGEELTKERNIFDITDDLVYNFNKSQKIKLTDDKGLTKSYGNITALRDIKEPGYYYI 80
gi 66391272   2 ALINFKEITESDTLKALTEAVNNIGTELSEDGNIFAKVEKLETQSASTPKYYLVQDSGKAKQVSSRSSLSSITQTGFYYV 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66394966  81 GARTLATLLDRPDMESLDVVLHVVPLDTSSKVVQHLYTLSTNNNQIKMLYRFVSGNSSSEWQFIQGLPSNKNAVISGTNI 160
gi 48696456  81 GARTLATLLDRPDMESLDVVLHVVPLDTSSKVVQHLYTLSTNNNQIKMLYRFVSGNSSSEWQFIQGLPSNKNAVISGTNI 160
gi 66391272  82 SSNVSFYISELPQELRTDLLLSVYQTEVG--VVQFINTISTVESKKYFAYRVNYNGMAGSWRFIDSRINNRSTLVVGGSY 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66394966 161 LDIASPGVYFVMGMTGGMPSGVSSGFLDLSVDANDNRLARLTDAETGKEYTSIKKPTGTYTAWKKEFEPKDMEKYLLSSI 240
gi 48696456 161 LDIASPGVYFVMGMTGGMPSGVSSGFLDLSVDANDNRLARLTDAETGKEYTSIKKPTGTYTAWKKEFEPKDMEKYLLSSI 240
gi 66391272 160 KDIITPGNYIVNSLK-DLPDSNSDGYLSVITNQSDER-SYIYISPDNKMYHSVSNQSKDY-EWVKEFETKDIEKYLLTNL 236
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66394966 241 RDDGSASFPLLVYTSDSKTFQQAIIDHIDRTG-QTTFTFYVQGGVSGSPMSNSCRGLFMSDTPNTSSLHGVYNAIGTDGR 319
gi 48696456 241 RDDGSASFPLLVYTSDSKTFQQAIIDHIDRTG-QTTFTFYVQGGVSGSPMSNSCRGLFMSDTPNTSSLHGVYNAIGTDGR 319
gi 66391272 237 ----DGSFNLLIYSNEGKSFETKVLEYLNSLDkPRTFTFYIQGGVSGNPSSGSCRGLFVIDSIN----YGNYYMIDNYGN 308
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66394966 320 NVTGSVVGSNWTSPKTSPSHKELWTGAQSFLSTGTTNNLSDDISNYSYVEVYTTHKTTEKTKGN--DNTGTICHKFYLDG 397
gi 48696456 320 NVTGSVVGSNWTSPKTSPSHKELWTGAQSFLSTGTTKNLSDDISNYSYVEVYTTHKTTEKTKGN--DNTGTICHKFYLDG 397
gi 66391272 309 LFTGSLNNGALLKAKPSTSSDVLWTGAKNFTDKGTVETLKFPIADYEYVKIFVTVPSQGPNTSDitNDLQNGAHEFYIKG 388
                       410       420       430       440       450       460
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 66394966 398 SGTYVCSGTFVSGDRTDTKPPITEFYRVGVSFKGSTWTLVDSAVQNSKTQYVTRIIGINMP 458
gi 48696456 398 SGTYVCSGTFVSGDRTDTKPPITEFYRVGVSFKGSTWTLVDSAVQNSKTQYVTRIIGINMP 458
gi 66391272 389 QSRASVSGLVVSSDTK------FDLYRVGIAFGQKSWRITDMAKTNTKNAYITRIVGINY- 442
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap