Conserved Protein Domain Family
PHA01819

?
PHA01819: PHA01819 
hypothetical protein
Statistics
?
PSSM-Id: 107089
View PSSM: PHA01819
Aligned: 4 rows
Threshold Bit Score: 88.5074
Threshold Setting Gi: 157738607
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29565742    1 MTEFDEIVKPDDKEETSESTEENLESTEETSesteESTEESTEESTEDKTVETIEEENENKLEPTTTDEDSSKFDPVVLE 80
gi 66395202    1 MTEFDEIVKPDDKEETSESTEENSESTEETS----ESTEESTEESTEDKTVETIEEENENKLEPTTTDEDSSKFDPVVLE 76
gi 157738607   1 MTEFEEIVKPDDKEPTE------------------EPTEEPTEEPTEDKTVETIEEENKNKLEPTITDEDSSKFDPVILE 62
gi 29565765    1 MTEFDEIVKPDDKEETSESTEENLESTEETSesteESTEESTEESTEDKTVETIEEENENKLEPTTTDEDSSKFDPVVLE 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|...
gi 29565742   81 QRIASLEQQVTTFLSSQMQQPQQVQQTQSDVTESNKEDNDYSDEELVDKLDLD 133
gi 66395202   77 QRIASLEQQVTTFLSSQMQQPQQVQQTQPDVTESDKEDNDYSDEELVDKLDLD 129
gi 157738607  63 QRITSLEQQMTTFLSSQIQQP---QQTQPDVTNADKEDKDYSDEELVDKLDLD 112
gi 29565765   81 QRIASLEQQVTTFLSSQMQQPQQVQQTQSDVTESNKEDNDYSDEELVDKLDLD 133
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap