Conserved Protein Domain Family
PHA02086

?
PHA02086: PHA02086 
hypothetical protein
Statistics
?
PSSM-Id: 107108
View PSSM: PHA02086
Aligned: 3 rows
Threshold Bit Score: 88.2158
Threshold Setting Gi: 37651484
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
37651484   1 MTLYEELNNALERVCRINIRFMGDQQHADELTENVSGPLERLRIGQASRRDMGVLCASGIVHEANLFGANIPNVIDEMIE 80 
109289989  1 MTLYEEISETLVRICRINVRFMGDEETADELSDEVNPIIANIKAGIATRKELGRLCHLGLVHEANLYGSDWGKIVSKMEH 80 
66391807   1 MTLYEELNNALERVCRINIRFMGDQQHADELTENVSGPLERLRIGQASRRDMGVLCASGIVHEANLFGANIPNVIDEMIE 80 
37651484  81 KMKAEVQY 88 
109289989 81 RMKKEHSY 88 
66391807  81 KMKAEVQY 88 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap