Conserved Protein Domain Family
PHA02087

?
PHA02087: PHA02087 
hypothetical protein
Statistics
?
PSSM-Id: 107109
View PSSM: PHA02087
Aligned: 3 rows
Threshold Bit Score: 129.302
Threshold Setting Gi: 37651487
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66391810   1 MKIVRVKFKSPEHRKAFAETEWYNLEFEKFMPDEFWARFDPNKVVQYCLVDSDGVKIELPESEGGGGITFDDEEMFHFFD 80
gi 37651487   1 MTIKRIRFKSEEHRKKFAESEWYNESFSKHMPDEFWAKYDSNKLVGYMLVDANGKKIELPEEEGGGGITFDDEEMFHFFD 80
gi 109289992  1 MKIVRVKFKSPEHRKAFAKSASYNAEFEKFMPDEFWLGFDPNKNVQYRLVDSDGVVIELPESTGGGGIIFDDEELYYFME 80

                ...
gi 66391810  81 EVK 83
gi 37651487  81 EVK 83
gi 109289992 81 IIE 83
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap