Conserved Protein Domain Family
PHA02095

?
PHA02095: PHA02095 
hypothetical protein
Statistics
?
PSSM-Id: 107115
View PSSM: PHA02095
Aligned: 3 rows
Threshold Bit Score: 154.362
Threshold Setting Gi: 109290004
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109290004  1 MTVVFGEGLKKPLLLSHVTWHDGKVQSAYVINGAWEFSRVDGVLCVEGDADSPMEEFQIVIDVPQAfVSDDYNTIIEWAK 80
gi 37651501   2 RIAAFRKGGTNPVLLNFFSMTEGVIQNGYVENGSWEFSRVDGILCIEGDKEHPMPDFEHIVEVPDE-MAGDYNEIISWAE 80
gi 66391823   2 RIAAFRKGGTNPVLLNFFSMTEGVIQNGYVENGSWEFSRVDGILCIEGDKEHPIPDFEHIVEVPDE-MAGDYNEIISWAE 80

                ....*
gi 109290004 81 NEASK 85
gi 37651501  81 KQLEL 85
gi 66391823  81 KQLEL 85
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap