Conserved Protein Domain Family
PHA02099

?
PHA02099: PHA02099 
hypothetical protein
Statistics
?
PSSM-Id: 107119
View PSSM: PHA02099
Aligned: 3 rows
Threshold Bit Score: 105.104
Threshold Setting Gi: 66391853
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66391853   1 MEFKIIVKSSAKGPVDQYIANLKNAGRVGPGESEMHILRNFEGVDIVFHAEGYNPDLYAELKRHVCYIVNTVKTPTGASV 80
gi 37651531   1 MEFKIIVKSSAKGPVDQYIANLKNAGRVGPGESEMHILRNFEGVDIVFHAEGYNPDLYAELKRHVCYIVNTVKTPTGASV 80
gi 109290037  1 MEFKIIVSSRHAGPIDRYIMDLKNIDRVSPGGCEMHILRTTSGADIIFHADGYDPELYNEVHRYAHYILNTVKVPAGAHV 80

                ....
gi 66391853  81 IGWF 84
gi 37651531  81 IGWF 84
gi 109290037 81 VGVV 84
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap