Conserved Protein Domain Family
PHA02100

?
PHA02100: PHA02100 
hypothetical protein
Statistics
?
PSSM-Id: 107120
View PSSM: PHA02100
Aligned: 3 rows
Threshold Bit Score: 224.178
Threshold Setting Gi: 37651535
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37651535    1 MSNQFIAVRNFTVHTCAAKFATDNILGNRISEEQINAVENEVWEAATAAGVTGIGRQAIRSVIVQYISEEFGTQALGHTP 80
gi 109290038   1 MSNAFIAVRNFAVHTAAAEFTTDNILGREITEQMIDKVENTVWDAMMEAGVTGIGRRAIRSVIVQYIADEFGTQPLGHTP 80
gi 66391857    1 MSNQFIAVRNFTVHTCAAKFATDNILGNRISEEQIDAVENEVWEAATAAGVTGIGRQAIRSVIVQYISEEFGTQALGHTP 80
                         90       100       110
                 ....*....|....*....|....*....|..
gi 37651535   81 THIGPKTMAEDAYKKYQGKARKIRQEIYGSKK 112
gi 109290038  81 THAGYKQVAEDAYKKYQGKARKIRQEMYGSKR 112
gi 66391857   81 THIGPKTMAEDAYKKYQGKARKIRQEIYGSKK 112
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap