Conserved Protein Domain Family
PHA02105

?
PHA02105: PHA02105 
hypothetical protein
Statistics
?
PSSM-Id: 133990
View PSSM: PHA02105
Aligned: 3 rows
Threshold Bit Score: 80.581
Threshold Setting Gi: 37651550
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 37651550   1 MQIKLTKEDWESAKYQNDQNEYPVELELFDQLKTVFSIPQIKYVYLSYEEFNSIMPFIPRRSGFSHVR 68
gi 66391872   1 MQIKLTKEDWESAKYQNDQNEYPVELELFDQLKTVFSIPQIKYVYLSYEEFNSIMPFIPRRSGFSHVR 68
gi 109290050  1 MQIKLTRNEFKKALENNDQYEYPLNNETINQLRSVFSVPQVEYVYLSFQEYQSILPIIPAM------- 61
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap