Conserved Protein Domain Family
PHA02110

?
PHA02110: PHA02110 
hypothetical protein
Statistics
?
PSSM-Id: 107130
View PSSM: PHA02110
Aligned: 3 rows
Threshold Bit Score: 143.53
Threshold Setting Gi: 109290056
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66391879   1 MELEIIKVYLESKIQLESLFGNSVGEVEIF-KSHWMIRDGFVFIGDPP--IDPDLCVVFEKVRYIHKSNEIHAIMVDDYV 77
gi 109290056  1 MELNIVKVYLESKLQVESLIGNKVGELEIFaKEYWLVKDGFIFLHDKLgiSENDCSLCYEILRKCHVSDEITVFMVDDYV 80
gi 37651557   1 MELEIIKVYLESKIQLESLFGNSVGEVEIF-KSHWMIRDGFVFIGDPP--IDPNLCVVFEKVRYIHKSNEIHAIMVDDYV 77
                        90       100
                ....*....|....*....|.
gi 66391879  78 SETHKIICLFPEKKicqvEKQ 98
gi 109290056 81 SESAKAIVVITDKE----DKA 97
gi 37651557  78 SETHKIICLFPEKKicqvEKQ 98
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap