Conserved Protein Domain Family
PHA02114

?
PHA02114: PHA02114 
hypothetical protein
Statistics
?
PSSM-Id: 107131
View PSSM: PHA02114
Aligned: 3 rows
Threshold Bit Score: 241.024
Threshold Setting Gi: 109290065
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109290065   1 MQIILKSAGEGKTAEAIKSAYMAAMNHPVLIVSSKEHPSVLEHRVNMFSIQNPAIKNRYDIVTCVEPATPEMFKDLGYFD 80
gi 37651567    1 MKLILRTANAGKTQEAIKSAFEAAQHHEVMFVSDEMPYTEILRRLTAFSSENPAMQNRYIISTALAQAKPEMFDDLEAFD 80
gi 66391889    1 MKLILRTANAGKTQEAIKSAFESAQHHEVMFVSDELPYTEILRRLNAFSSENPALQNRYIISTSVLPADPEMFDNLTAFA 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|
gi 109290065  81 RFGTIILDVNFAMSRGPWITVCAELEAYGYEVIATQELVKPAQKShkvYH 130
gi 37651567   81 QYGTIVLDVNYAMSRAPWIKVISRLEEAGFNVVATQMLVKPVAPT---FH 127
gi 66391889   81 QYGTIVLDVNYAMSRAPWIKVISRLEEAGFNVVATQQLLKTSAPT---FH 127
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap