Conserved Protein Domain Family
PHA02123

?
PHA02123: PHA02123 
hypothetical protein
Statistics
?
PSSM-Id: 107137
View PSSM: PHA02123
Aligned: 3 rows
Threshold Bit Score: 217.283
Threshold Setting Gi: 37651586
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109290080   1 MKKSIAAILALSIYGCGAAAPVTANMNEMFWFPEKSGVIKEFTDENGKYESALSVSCDMQYTQKHDDCLGIIFNSDYWII 80
gi 37651586    1 MKKSIATLIAIGMYGCSAVAPVTANVNEMFHFPQKSGVIQEFTDENGTYESALSASCDREVREQYDNCLGIVFNSDYWLI 80
gi 66391907    1 MKKSIATLIAIGMYGCSAVAPVTANVNEMFHFPQKSGVIQEFTDENGTYESALSASCDREVREQYDNCLGIVFNSDYWLI 80
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 109290080  81 DSARSDNSILSRSERVMISFDGVVQNVYYVRTGSAIVIWRKDNPDFNPMGKVMSITTPYGKGEFTL 146
gi 37651586   81 DGARDDKNILVGTERVMISLNGIVQNVDYIRSGSAIVIRRMDNPTFNPIGDVLSITTSSGKGEFTL 146
gi 66391907   81 DGARDDKNILVGTERVMISLNGIVQNVDYIRSGSAIVIRRMDNPTFNPIGDVLSITTSSGKGEFTL 146
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap