Conserved Protein Domain Family
PHA02127

?
PHA02127: PHA02127 
hypothetical protein
Statistics
?
PSSM-Id: 107140
View PSSM: PHA02127
Aligned: 3 rows
Threshold Bit Score: 89.3648
Threshold Setting Gi: 37651594
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 37651594   1 MSNVTHLVNFGHGELAVKKVASYFHVLKSADPMLPVGTEFPIKDTVTLDADVIQLNA 57
gi 66391915   1 MSNVTHLVNFGHGELAVKKVASYFHVLKSADPMLPVGTEFPIKDTVTLDADVIQLNA 57
gi 109290091  1 MSNVTHLVNFGFGQLSVQQIGSYFHVINSADAMMPIGTRFPIKDTVKLEADVIQLNG 57
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap