Conserved Protein Domain Family
PHA02128

?
PHA02128: PHA02128 
hypothetical protein
Statistics
?
PSSM-Id: 107141
View PSSM: PHA02128
Aligned: 3 rows
Threshold Bit Score: 311.225
Threshold Setting Gi: 37651595
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66391916    1 MSIVKERFFNYKTFFIDAINRSYANKPSGCIQEMSQPKSSFLREHRTIHLNLGRMTGKTTGLLHLANEVSAQGGARIITM 80
gi 37651595    1 MSIVKERFFNYKTFFIDAINRSYANKPSGCIQEMSQSKSSFLREHRTIHLNLGRMTGKTTGLLHLANEVSAQGGARIITM 80
gi 109290092   1 MSIVKERFFNYKTFFVEAINRAYDNFPAGCSQELYQPKSSFLREHRTIHLNLGRITGKTSGLIQLANELVAQGGVRLITM 80
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 66391916   81 NSANKRHVQDMVSYQWRGDIRISTISELTDRCPKVKFLMIDESEYTLTSRHQRQEIYDWAGTHGVEFVIMT 151
gi 37651595   81 NSANKRHVQDMVSYQWRGDIRISTISELTDRCPKVKFLMIDESEYTLTSRHQRQEIYDWAGTHGVEFVIMT 151
gi 109290092  81 NPANKRHVKDMVLGPWRGDIQISTMSELTNHCPCVKFLMIDESEYTLTSRHHRQEIYDWAGTHGVEFVIMT 151
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap