Conserved Protein Domain Family
PHA02130

?
PHA02130: PHA02130 
hypothetical protein
Statistics
?
PSSM-Id: 107142
View PSSM: PHA02130
Aligned: 3 rows
Threshold Bit Score: 157.878
Threshold Setting Gi: 37651604
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37651604   1 MKTISPTGKEKTFKSWESLREWLDERFDSWDDDILSIPFKSTVYWDLCPYAQDIHNGQENLVWNTDKDELEKQLELIAEE 80
gi 66391925   1 MKTISPTGKEKTFKSWESLREWLDERFDSWDDDILSIPFKSTVYWDLCPYAQDIHNGRENFVWNTDKDALEEHLKMIAQE 80
gi 109290099  1 MKTISPAGKEKTFKSCQSLKDWLSANCDSWDDDILDIPFKSTVHWGLCPFDQDIYNGKETFVWNFCKTLLEKELESRAQE 80

                .
gi 37651604  81 I 81
gi 66391925  81 I 81
gi 109290099 81 I 81
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap