Conserved Protein Domain Family
PHA02131

?
PHA02131: PHA02131 
hypothetical protein
Statistics
?
PSSM-Id: 107143
View PSSM: PHA02131
Aligned: 3 rows
Threshold Bit Score: 135.59
Threshold Setting Gi: 109290101
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109290101  1 MKIYHPQHIAKVNGITKVDMIRGHKTQGFHCYIMFKDGKVTDCTFKHDTAQFRNMEKIAREVAAEHQYTL 70
gi 66391927   1 MKIYHPQHIAKVNGITKVDMIRGHYRFGISCWIMFKNDQVIDCTFKNDTAQFRSMEKAARQVAAEHQYTL 70
gi 37651606   1 MKIYHPQHIAKVNGITKVDMIRGHYRFGISCWIMFKNDQVIDCTFKNDTAQFRSMEKAARQVAAKHQYTL 70
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap