Conserved Protein Domain Family
PHA02132

?
PHA02132: PHA02132 
hypothetical protein
Statistics
?
PSSM-Id: 107144
View PSSM: PHA02132
Aligned: 3 rows
Threshold Bit Score: 138.519
Threshold Setting Gi: 109290102
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109290102  1 MQFLFELFAASVQYTAVALIVYVLLHGYAFFDEWRRGKPDSKFPAKSLSSVQIYGTIAAAWLPVVLFLLWKLIEFIYVKV 80
gi 66391928   1 MNLLFELFILSVQYSIIAVMVYVLIHGFAFFDEWRQKRPDSKMPARSLCAVQVYGMIAGAWLPLAIYLVCKLCEFTYIKV 80
gi 37651607   1 MNLLFELFILSVQYSIIAVMVYVLIHGFAFFDEWRQKRPDYKMPARSLCAVQVYGMIAGAWLPLAIYLVCKLCEFTYIKV 80

                ....*...
gi 109290102 81 VvdKIYKK 88
gi 66391928  81 T--EKIKK 86
gi 37651607  81 T--EKIKK 86
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap