Conserved Protein Domain Family
PHA02135

?
PHA02135: PHA02135 
hypothetical protein
Statistics
?
PSSM-Id: 107145
View PSSM: PHA02135
Aligned: 3 rows
Threshold Bit Score: 117.132
Threshold Setting Gi: 66391967
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
109290142   1 MNCTKRFENAIVHDEYMVFSKNWINQSDFAVKVIKMFNENTEHGGCApAVEPMENWPSKSYLSDMPRLFMLKRYGWELAH 80 
66391967    1 MNCMKRFSSAILEDKYLVTMNDWTREAEFADKVISKFNDNTSNYPGI-SVPPMKGKPTMGYLGEMTRLFFIQRYNKENNK 79 
37651646    1 MNCMKRFSSAILEDKYLVTMNDWTREAEFADKVISKFNDNTSNYPGI-SVPPMKGKPTMGYLGEMTRLFFIQRYNKENNK 79 
109290142  81 DYRQWCKDNPGEILTVEVFGSPESKIPTSFMMKYEKGFKFKLF 123
66391967   80 DWRKWCRENPGKILVIEVVGDAKSEKPCQLEMQYEKGFWLRLM 122
37651646   80 DWRKWCRENPGKILVIEVVGDAKSEKPCQLEMQYEKGFWLRLM 122
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap