Conserved Protein Domain Family
PHA02142

?
PHA02142: PHA02142 
putative RNA ligase
Statistics
?
PSSM-Id: 134000
View PSSM: PHA02142
Aligned: 4 rows
Threshold Bit Score: 509.487
Threshold Setting Gi: 189490507
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37651690    1 MIINDERQLASMRKIADLQPIPGADAIEVATIDGWEVVVKKGEFRVGSDCVYFEIDSLLPTDHPAFRFLETRA---KIYD 77
gi 109290186   1 MIINNERQLASIRKIADLQPIPGADAIECATIDGWEVVVKKGEFTIGDDCVYFEIDSMLPMDNPAFKFLESRA---RMYE 77
gi 66392010    1 MIINDERQLASMRKIADLQPIPGADAIEVATIDGWEVVVKKGEFRVGSDCVYFEIDSLLPTDHPAFRFLETRA---KIYD 77
gi 189490507   8 AVVENTRKLVRVVKVDAITPIKKADFIELAKIDGWQCVVKKDEFKAGDLAVYAEIDSLLPLDNPLFAFLGERSdgkRTFD 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37651690   78 GKMRARIKTIKLRGQISQGIALPTGAFTVGELLggqemDKTIDQMLDIIKYEPPQDGTGCNPGG---------------- 141
gi 109290186  78 GKMRARVKTIKLRGQLSQGIALPINAFTIGELL-----DQSLDQILGIIKYEPAQDGSGCNPAG---------------- 136
gi 66392010   78 GKMRARIKTIKLRGQISQGIALPTGAFTVGELLggqemDKTIDQMLDIIKYEPPQDGTGCNPGG---------------- 141
gi 189490507  88 GVAYSRIRTAKMRGEVSQGLLLP-----LPEQFkgkkvGTNLTNELGVRKLEAEIANVDGFDGRlnkdgpislwerlarf 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37651690  142 -----------TFPIFIPKTDEERCQNIFNRYKEKYAD-VKFAKSLKLDGSSITMAWVTDPE------------------ 191
gi 109290186 137 -----------TFPVFIPKTDEERCQNIFTKYSACYKD-VVFQKSLKLDGSSITMAWVTDPD------------------ 186
gi 66392010  142 -----------TFPIFIPKTDEERCQNIFNRYKEKYAD-VKFAKSLKLDGSSITMAWVTDPE------------------ 191
gi 189490507 163 vagppaeamhlPFPAQISKSDQERVQNIGNQYAEAAASgETFEETVKVDGQSMTVYSFRDMDeagpirrygvcsrnfdmr 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37651690  192 ----------------------------------LFLDLGTEEEPYAHDYDDAQF--------------IVASRNQVLRY 223
gi 109290186 187 ----------------------------------LFLELGTEDEPYAHDYDDAQF--------------ILASRNQVLRY 218
gi 66392010  192 ----------------------------------LFLDLGTEEEPYAHDYDDAQF--------------IVASRNQVLRY 223
gi 189490507 243 mtdvvftpvqafrrfvaqnmlalsggfsglfrtaQFLTKQVMDKKLDADYAIKEYftkryfwfspfkmcIAAMDDNCVNY 322
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37651690  224 NADSKWWKGVENYQIVDRLKELRMSVAIQGELMGPGIQKNRENFDKYRIFAFRAFFIDEQRFATDEEFQDLCRTLGMEIC 303
gi 109290186 219 NPESKWWMGVENYQIIEQLKKMGKSVAIQGELMGPGIQKNRENFDKYRIFAFRAWFIEEQRFATDEEFHDLCRALGMEMV 298
gi 66392010  224 NADSKWWKGVENYQIVDRLKELGMSVAIQGELMGPGIQKNRENFDKYRIFAFRAWFIDEQRFATDEEFQDLCRTLGMEIC 303
gi 189490507 323 VITNKVLDKLAAYNVLHD-----DCITVQGELFGPGIQKNYERPAEKRFAVYQV-YRNGSEWVKPIEARAITESIGLEYV 396
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 37651690  304 PQLGYSYPFQEFTNVKDMLAAAD--------------IPSIEHKIAEGVVYKSVELVDGRMVHFKAINNKFLLKCED 366
gi 109290186 299 PQLGRCKPFEQFETVKEMLADAD--------------IPSINHKIAEGVVYKSVDLVNGQMIHFKAINNKFLLKCED 361
gi 66392010  304 PQLGYSYPFQEFTNVKDMLAAAD--------------IPSIEHKIAEGVVYKSVELVDGRMVHFKAINNKFLLKCED 366
gi 189490507 397 KVLNGSTTLPK--SVKEVLTRAKgkgayaafdpsinaVPDINR---EGIVFKS----NTRDFSFKVISTEYLLEAEA 464
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap