Conserved Protein Domain Family
PHA02145

?
PHA02145: PHA02145 
hypothetical protein
Statistics
?
PSSM-Id: 107148
View PSSM: PHA02145
Aligned: 3 rows
Threshold Bit Score: 409.352
Threshold Setting Gi: 109290199
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37651703    1 MSQRHGRFWSIGFNAVGYTGSLPAPNWGTQIRRFAGLNPVGNGLDPALSEFYFGQGAQPAGRWMSQYFNRGRTPSRCFMW 80
gi 109290199   1 MSQRHGRFWSIGYNAIGYTGDIKKPNWFTNVRRFAGLSAAGNAADPQLSSFYFGQGASPNGRWASSYFNKSRSPSRCYMW 80
gi 66392023    1 MSQRHGRFWSIGFNAVGYTGSLPAPNWGTQIRRFDGLNPVGNGLDPALSEFYFGQGVQPAGRWMSQYFNRGRTPSRCFMW 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37651703   81 SGSRYPYNSWSGFDWGGELTQIANATIKIGWIGTGRASHRGGD----MGYINLRWKWDNDLWQETRIFTTPDTYVSDWYG 156
gi 109290199  81 SGSRYPYNRNQNFSYSTEFTQVQRATIKIGYIGTGGASHRDGEntktAGYINLRWRWDNQPWQETRVYTTPTQYVSDWYG 160
gi 66392023   81 SGSRYPYNSWSGFDWGGELTQIANATIKIGWIGTGRASHRGGD----MGYINFRWKWDNDLWQETRIFTTPDTYVSDWYG 156
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 37651703  157 NRVMNLNRPgGGRGTLTFKIVGNVGDFDQHDVGDRGPNASWSPVVDMSVAGSG----YQGELFKSFQGHQTRQYNENN 230
gi 109290199 161 SRTFNFTHP-TGRGRIQFEVFGNYGDFDQHDVGDRGKDSSWSPYLNMALPGAGhlaaYNGELFKSFSGHQTREYSENN 237
gi 66392023  157 NRVMNLNRPgGGRGTLTFKIVGNVGDFDQHDVGDRGPNASWSPVVDMSVAGSG----YQGELFKSFQGHQTRQYNENN 230
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap