Conserved Protein Domain Family
PHA02146

?
PHA02146: PHA02146 
hypothetical protein
Statistics
?
PSSM-Id: 107149
View PSSM: PHA02146
Aligned: 3 rows
Threshold Bit Score: 94.7326
Threshold Setting Gi: 66392026
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
109290203  1 MEIEIDKKYRVIDASRFEKEHGIKNGHEFFVDSLDEDGDIWSRGISWNGIDGDSDDAPYIGWALLMKGYQDHCPEaPADY 80 
66392026   1 MQIEIGKKYRVTDAERFMAEHGITNGTEFTVTNIDDDGDLYTYDISWNGRDGKSAFAPSEGWALLLNGRNGNTDE-KADY 79 
37651706   1 MQIEIGKKYRVTDAERFMAEHGITNGTEFTVTNIDDDGDLYTYDISWNGRDGKSAFAPSEGWALLLNGRNGNTDE-KADY 79 
109290203 81 SGAIEQV 87 
66392026  80 TGSIEEV 86 
37651706  80 TGSIEEV 86 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap