Conserved Protein Domain Family
PHA02150

?
PHA02150: PHA02150 
hypothetical protein
Statistics
?
PSSM-Id: 134001
View PSSM: PHA02150
Aligned: 3 rows
Threshold Bit Score: 128.586
Threshold Setting Gi: 66392045
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 37651727   1 MLYRFVSEEQFNAWSSQNYAKEFAKHFKKWDDVFATEDLSCEGMTDWAEINGQYICSSHWYPFVSDDLGSRLVEVEA 77
gi 66392045   1 MLYRFVSEEQFNAWSSQNYAKEFAKHFKKWDDVFATEDLSCEGMTDWAEINGQYIRSSYWYPFVSDDLGSRLVEVEE 77
gi 109290219  2 VKYRFVSEEQFNAWAKQNYAQEFAFAFDSWDTIFEMEDIGRKVCSDTIEIDGEIYMSTQWYPFNITDLGNRIIEVKE 78
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap