Conserved Protein Domain Family
PHA02239

?
PHA02239: PHA02239 
putative protein phosphatase
Statistics
?
PSSM-Id: 107154
View PSSM: PHA02239
Aligned: 3 rows
Threshold Bit Score: 484.884
Threshold Setting Gi: 66395000
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66395000   1 MAIYVVPDIYGEYQKLLTIMDKINNERKPEETIVFLGDYVDRGKRSKDVVNYIFDLMSNDDNVVTLLGNHDDEFYNIMEN 80
gi 48696397   1 MAIYVVPDIHGEYQKLLTIMDKINNERKPEETIVFLGDYVDRGKRSKDVVNYIFDLMSNDDNVVTLLGNHDDEFYNIMEN 80
gi 66391303   1 MSIFVIPDIHGEYDKLMRLMNKIIEERKPEDTIVFLGDYIDRGDRSKDVVNYLFDLLLNDENVVALLGNHDDELYRIIEN 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66395000  81 VDRLSIYDIEWLSRYCIETLNSYGVSTVTLKYSSVEENLRNNYDFIKSELKKLKESDDYRKFKILMVNCRKYYKEDKYIF 160
gi 48696397  81 VDRLSIYDIEWLSRYCIETLNSYGVSTVTLKYSSVEENLRNNYDFIKSELKKLKESDDYRKFKILMVNCRKYYKEDKYIF 160
gi 66391303  81 IDRLGIYDIEWLSRYCMETLDSYGVDIATLTCNIVEDVLRNDYDFIKNELNKLKESEDYRKFKVFMTNCRRYYKKDKYIF 160
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 66395000 161 SHSGGVSWKPVEEQTIDQLIWSRDFQPRKDGFTYVCGHTPTDSGEVEINGDMLMCDVGAVFRNIDFPFIKLEVKK 235
gi 48696397 161 SHSGGVSWKPVEEQTIDQLIWSRDFQPRKDGFTYVCGHTPTDSGEVEINGDMLMCDVGAVFRNIDFPFIKLEVKK 235
gi 66391303 161 THSGGVSWKPVEGQTVDQLMWSRDFQPRKDGFIHVCGHTPTSSGQVEKHNDMLLCDVGAVFRDIELPFIKLEELE 235
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap