Conserved Protein Domain Family
PHA02243

?
PHA02243: PHA02243 
hypothetical protein
Statistics
?
PSSM-Id: 107156
View PSSM: PHA02243
Aligned: 3 rows
Threshold Bit Score: 112.501
Threshold Setting Gi: 66395038
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66395038   1 MANEKEIIRMVNYLIDNMSMWHINYARAVLIPSEVEKIIKEHEKFDDLLKKRGEWLVKGSDTDNIDDLETYNQIMNNQKD 80
gi 48696402   1 MANEKEIIRMVNYLIDNMSMWHINYARAVLIPSEVEKIIKEHEKFDDLLKKRGEWLVKGSDTDNIDDLETYNQIMNNQKD 80
gi 66391333   1 -MDNKEIKRLFDYLINSSRFWHLEYAKKTLIPSEYNKIVKECDKFDNLLRKRVDNLINNNYKGKPTDIDNYNQIFS--KD 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66395038  81 EMMIQEIDIYTQGKTITIDNEHYSSDDLGEVLNKLEQSEDIKIKSNYKSLYVGYTNVVGYEVTYASSYEETFKNDLEKDL 160
gi 48696402  81 EMMIQEIDIYTQGKTITIDNEHYSSDDLGEVLNKLEQSEDIKIKSNYKSLYVGYTNVVGYEVTYASSYEETFKNDLEKDL 160
gi 66391333  78 VLMIKEIKIYTDVDCITISKEDYTKEELDNTIKLLKDGEDIELNSFYKNLFLSSSIIKGYEVEYTSSYEDAIKKG---GI 154
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap