Conserved Protein Domain Family
PHA02244

?
PHA02244: PHA02244 
ATPase-like protein
Statistics
?
PSSM-Id: 107157
View PSSM: PHA02244
Aligned: 2 rows
Threshold Bit Score: 568.98
Threshold Setting Gi: 157325113
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66394973    1 MAKQDTIERLerlveqqmettkdladklgeknsnpyEQAIVDAIVEKAGTESREIIITDVKKQIEEYVEEQLSNLPvkie 80
gi 157325113   1 MSIYESIEGL--------------------------EQSIIEGLRTTLETEGKNIALDVIRKELEDSPFLRFFELS---- 50
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66394973   81 lqqEGKTIKDISGI----------FHYRYQDILKLVNQNIPVFLKGGAGSGKNHVLEQVAEALDLDFYFSNAITQEFKLT 150
gi 157325113  51 ---QGSPAGDVYQVdttkiasnptQHYETARVASIVSANVPVWLWGQAGTGKTSIAQSIAKMLDLEFYPMQKIMDEFELK 127
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66394973  151 GFIDANGKFHETQFYKAFTKGGLFFLDEMDASIPEVLLILNSAIANKYFDFPIGRVTAHEDFRVVSAGNTMGTGADHIYv 230
gi 157325113 128 GFVDANSRFVPTPLYEAMKNGGLLFIDEIDASVPEALILINTALANNFMRFADETVYAHKDFRVIVAGNTLGKGGNNSY- 206
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66394973  231 GRQQLDGATLDRFAQVEFDYDTKVEHQLSS-NEDLVNFVQQLRHENDEKGLPYVFSMRAIINGSKLDGvMEDEFVVESII 309
gi 157325113 207 ARNKIDSATLDRFVPIEIGYDEKIELLITNgDRELVYFVALVRIVMARTKLDHVISYRALSHYKKFES-FGADFLIENVL 285
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 66394973  310 FKSVPKDEINQFISSLPEGNRYTEATRKLlgmqqepkqeprksdSTSKDSMDFDTIMDKLGLE 372
gi 157325113 286 FKTLSLEDITSIARSLSRVIKETDNDYKW---------------KNNKVGKQLQTYLSNKGVV 333
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap