Conserved Protein Domain Family
PHA02264

?
PHA02264: PHA02264 
hypothetical protein
Statistics
?
PSSM-Id: 107161
View PSSM: PHA02264
Aligned: 3 rows
Threshold Bit Score: 127.15
Threshold Setting Gi: 48696440
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48696440   3 TFWSERRTTNKDRQVKKHYTQMSMYERKKCVELLQETITENRIINFTRHSAKKVKGKPTTNIpkLIGFIFKNKFAYENII 82
gi 66391336   1 MFYSERRTTCKERQRKKHYSQMTLQEKKDCVSLLQNVFEQCKFFKMTPHFKEKSLTRIDFDL--LKNFILHNNYAFLNII 78
gi 66395041   3 TFWSERRTTNKDRQVKKHYTQMSMYERKKCVELLQETITENRIINFTRHSAKKVKGKPTTNIpkLIGFIFKNKFAYENII 82
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48696440  83 EYNNTDYNGNIERRIVVKHPKVITVEGKPSYQFLTISlEDARVITVWYNSVDDTHRTLDLNYYSKDLTIQ 152
gi 66391336  79 EYNETKTRYNTQKRIVLKYPEIVKVKGIPCFQYLVIT-NNGKLVTTYYNKINDVHKTLDLTYYDKNLKIS 147
gi 66395041  83 EYNNTDYNGNIERRIVVKHPKVITVEGKPSYQFLTISlEDARVITVWYNSVDDTHRTLDLNYYSKDLTIQ 152
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap