Conserved Protein Domain Family
PHA02275

?
PHA02275: PHA02275 
hypothetical protein
Statistics
?
PSSM-Id: 107163
View PSSM: PHA02275
Aligned: 3 rows
Threshold Bit Score: 94.4127
Threshold Setting Gi: 66395056
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66395056   1 MKKYREYLNKTDAENLAEDWEKVTEDLWKVFKDMKPKINTLDISNVVSKDLDKSKPILQFQDSDGVIENICNVEGLEDGL 80
gi 48696461   1 MKKYREYLNKTDAENLAEDWEKVTEDLWKVFKDMKPKINTLDISNVVSKDLDKSKPILQFQDSDGVIENICNVEGLEDGL 80
gi 66391360   1 MVSY-----NNEDFNTVELTDILDKDQLIEFLVKNQKVNNLDISKVKQDKFDMNMAVLQFQDDENNLTNICNVENLDEGL 75
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*.
gi 66395056  81 SKMKKIFDDSNFE-KHYYNRVVDHDEYYWIDYGSHHCFFRVTKGDK 125
gi 48696461  81 SKMKKIFDDSNFE-KHYYNRVVDHDEYYWIDYGSHHCFFRVTKGDK 125
gi 66391360  76 DKIRQIFKDSELEhRLHYFRVVEHEDYYWIDYGSHHTFFRVTKRG- 120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap