Conserved Protein Domain Family
PHA02277

?
PHA02277: PHA02277 
hypothetical protein
Statistics
?
PSSM-Id: 107164
View PSSM: PHA02277
Aligned: 3 rows
Threshold Bit Score: 186.09
Threshold Setting Gi: 66391342
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48696465   1 MEKNISTHTKGISQADMEKWIEAAVQGTVDGKQVDEKTAKQLDRIGSRSVSLEEATRIAKVLNAVTAQEVTGDFNDAFNA 80
gi 66395045   1 MEKNISTHTKGISQADMEKWIEAVVQGTVDGKQVDEKTAKQLDRIGSRSVSLEEATRIAKVLNAVTAQEVTGDFNDAFNA 80
gi 66391342   1 MEKTVSTHAKDISTNDLNKWLEAVTTNRLNGKEIGEKETKELQRLGNRAVSLEVATRIAMSLAEHEVQNVASRL---LQS 77
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48696465  81 IDLMMIIMEDELGVTQEKVGKAKDKLNEKREAYLKEKQEELRQKQQEEAQKKTESDSNEKVIQLKKNDEQ 150
gi 66395045  81 IDLMMIIMEDELGVTQEKVGKAKDKLNEKREAYLKEKQEELRQKQQEEAQKKTESDSNEKVIQLKKNDEQ 150
gi 66391342  78 VDLIQQIMEDELGIDEEKLNKAVAKLNDKYEAYIKEQQEKIKEAQKKEV----ETDSNEKVVSMKPKNEQ 143
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap