Conserved Protein Domain Family
PHA02284

?
PHA02284: PHA02284 
hypothetical protein
Statistics
?
PSSM-Id: 107167
View PSSM: PHA02284
Aligned: 3 rows
Threshold Bit Score: 175.735
Threshold Setting Gi: 66394995
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66394995   1 MGIIVNSNHIQSDTLYEYDSFFDIEKVDTFEEGLLSI------QDEPTVLAGFIYdditfnkvinsNSDIDDYIK-NNDI 73
gi 66391301   1 MLIIYNKNHIQSKEVHKHLGYSVNENVCAVVNNQDAIkvvkesQDTDIMLVGFIY-----------TKDLECLVElGKTI 69
gi 48696483   1 MGIIVNSNHIQSDTLYEYDSFFDIEKVDTFEEGLLSI------QDEPTVLAGFIYdditfnkvinsNSDIDDYIK-NNDI 73
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66394995  74 YYVSDIGLLPDTFITVDsDRKYYSLLQQITELSKDPFP--KWVEDDAKGLTKYYNFQDfEDVFDLNSFYKKEVDMVREKC 151
gi 66391301  70 YWVSNIGTIPSLFKHVD-NSKIKSLLEQAVELLPEEYGvfEYTKESMKKATDYYNFKN-DDYLEEVDIDKDLIDMLAKKC 147
gi 48696483  74 YYVSDIGLLPDTFITVDsDRKYYSLLQQITELSKDPFP--KWVEDDAKGLTKYYNFQDfEDVFDLNSFYKKEVDMVREKC 151
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66394995 152 YNNGNVYLLYEVLPDYKLPLAYSLLSNKEHGIVIIGSQTRSNNDILTFYVKGMDAKAIASMFNVEHDYDSNIFHTFVNSH 231
gi 66391301 148 YTNGDLHFLYELDPKLRLPIAYSITRGKDKAIVVIGSQTASDNDMLSFYVKGYDVSKLANTFNAEYEVGNNTFTTFIPSH 227
gi 48696483 152 YNNGNVYLLYEVLPDYKLPLAYSLLSNKEHGIVIIGSQTRSNNDILTFYVKGMDAKAIASMFNVEHDYDSNIFHTFVNSH 231
                       250
                ....*....|....*..
gi 66394995 232 INILGNQITKFIREKGS 248
gi 66391301 228 INVVGKSIKKYMEDSDV 244
gi 48696483 232 INILGNQITKFIREKGS 248
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap