Conserved Protein Domain Family
PHA02290

?
PHA02290: PHA02290 
hypothetical protein
Statistics
?
PSSM-Id: 107168
View PSSM: PHA02290
Aligned: 3 rows
Threshold Bit Score: 146.123
Threshold Setting Gi: 48696492
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48696492   1 MRNKKSFQEQLNDMRNKEKWVSEEEFTEEVAPPEEPEVEEEKLYTLNELKESLLDAQGLKDVVADFP--ASKDLYEPNKL 78
gi 66395002   1 MRNKKSFQEQLNDMRNKEKWVSEEEFTEEVAPPEEPEVEEEKLYTLNELKESLLDAQGLKDVVADFP--ASKDLYEPNKL 78
gi 66391308   1 ----MSYQERLKEIRKQSDTHKEIN-------------NSKKKYTMDELELSLFDRDS--DVIKPFTsiSKDDEISSNDL 61
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48696492  79 YICTIPKGY---QSTEVQPGQYIGISTGLLSESEDFSHLRGQMPRNLYETSHVLKPLIRINNTNIEYQQHELLEDIKDDK 155
gi 66395002  79 YICTIPKGY---QSTEVQPGQYIGISTGLLSESEDFSHLRGQMPRNLYETSHVLKPLIRINNTNIEYQQHELLEDIKDDK 155
gi 66391308  62 FIATLPNNIvlaDGTTLEKGQYIGNSMGKLSDLEDMED-SGISSKTLYENGHRINLLAVVNNPKAVYTQKDLVVDIKDGV 140
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48696492 156 KIYDVELEDLRLATGEEVSHLEIVDNKFFESRINEVLDRYTELTDSNDLLKYYSKLRELVG-SDKMIYCSLLDKCVKIID 234
gi 66395002 156 KIYDVELEDLRLATGEEVSHLEIVDNKFFESRINEVLDRYTELTDSNDLLKYYSKLRELVG-SDKMIYCSLLDKCVKIID 234
gi 66391308 141 EVRDVTTKSSSVISKQKIDYISLVDESYFDNLIDDVLKDYNNLSNPNTLLKRYIKNKEMLGeGKKMIYCSLLDKEVLVVG 220
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap