Conserved Protein Domain Family
PHA02414

?
PHA02414: PHA02414 
hypothetical protein
Statistics
?
PSSM-Id: 107179
View PSSM: PHA02414
Aligned: 3 rows
Threshold Bit Score: 142.708
Threshold Setting Gi: 66395125
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158079516   1 MNDYQVNDLVLRLQRLEDKLQHGELTEKGikqDNVELNSAVSELRDIVNSLDKRLAVHEEKYAHLTYQITKLEETIDALE 80
gi 157325212   2 EKDTNIQSLLDKIKNLEDKVQTGELTRKT---DNEELTKAIKELRDIVVALDKDSALQSEKQSHIFYQIGQLEKGVEALR 78
gi 66395125    1 -MDKEINNLVSQVETIKSKIQEGNYIDRG---TFKDLEVEVAELRKMIVSIDKDVAVNSEKQSAIYVQLERLDEKISELA 76
                         90       100       110
                 ....*....|....*....|....*....|....
gi 158079516  81 GVNDKEFDHKRDIVENVFMIVLGAVVTYVFSMFK 114
gi 157325212  79 QTNQKEDEGKKDLVEKVFMIILGAVVTYVFSLVK 112
gi 66395125   77 ESTKTKDTEKKDTTEKVLLLVLGAILSFVFNKFA 110
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap