Conserved Protein Domain Family
PHA02416

?
PHA02416: PHA02416 
hypothetical protein
Statistics
?
PSSM-Id: 107181
View PSSM: PHA02416
Aligned: 3 rows
Threshold Bit Score: 365.581
Threshold Setting Gi: 134288695
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134288695   1 MPSKLFLYDANEANKDLLDYFKNKNYTRVALTNSTDFFWSQIDSVDNGGYLAIMSHGNNNTFEIAMGNPPKDMRQDQIVP 80
gi 134288757   1 MPSKLFLYDANEANKDLLDYFKNKNYTRVALTNSTDFFWSQIDSVDNGGYLAIMSHGNNNTFEIAMGNPPKDMRQDQIVP 80
gi 72537707    1 MPSKLFLYDANEANKDLLDYFKNKNYTRVALTNSTDFFWSQIDSVDNGGYLAIMSHGNNNTFEIAMGNPPKDMRQDQIVP 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134288695  81 FGTSLNQRNVTLYLLSCHTGNDPLGRSLLGTGCNFAAPKGYALVKSSSAGVGVYSVVDPHASDVKYAGWTGTEGVIPNRD 160
gi 134288757  81 FGTSLNQRNVTLYLLSCHTGNDPLGRSLLGTGCNFAAPKGYALVKSSSAGVGVYSVVDPHASDVKYAGWTGTEGVIPNRD 160
gi 72537707   81 FGTSLNQRNVTLYLLSCHTGNDPLGRSLLGTGCNFAAPKGYALVKSSSAGVGVYSVVDPHASDVKYAGWTGTEGVIPNRD 160

                 ....*..
gi 134288695 161 TKPLNIK 167
gi 134288757 161 TKPLNIK 167
gi 72537707  161 TKPLNIK 167
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap