Conserved Protein Domain Family
PHA02436

?
PHA02436: PHA02436 
hypothetical protein
Statistics
?
PSSM-Id: 107183
View PSSM: PHA02436
Aligned: 3 rows
Threshold Bit Score: 80.1666
Threshold Setting Gi: 77020185
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50
               ....*....|....*....|....*....|....*....|....*....|..
gi 77020185  1 MSEIYYKGFIIKETYGERNIEEVFKEAYESFYGVEVKVVKKELGTKRNSAAS 52
gi 85701410 10 MSEIYYKGFIIKETYGERNIEEVFKEAYESFYGVEVKVVKKELGTKRNSAAS 61
gi 89152508  1 MSEIYYKGFIIKETYGERNIEEVFKEAYESFYGVEVKVVKKELGTKRNSAAS 52
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap