Conserved Protein Domain Family
PHA02448

?
PHA02448: PHA02448 
hypothetical protein
Statistics
?
PSSM-Id: 107186
View PSSM: PHA02448
Aligned: 7 rows
Threshold Bit Score: 379.016
Threshold Setting Gi: 109522145
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109522145   1 MSEPDVEGLAKLREPFPPNQIGKLPKGGITLDFLGHGYLTARFLDVDPLWTWEPFAVGDNGLPLLDEHGGLWIRLTLCGV 80
gi 109392246   1 MSEPDVEGLAKLREPFPPNQIGKLPKGGITLDFLGHGYLTARFLDVDPLWTWEPFAVGDNGLPLLDEHGGLWIRLTLCGV 80
gi 157311253   1 MSEPDVEGLAKLREPFPPNQIGKLPKGGITLDFLGHGYLTARFLDVDPLWTWEPFAVGDNGLPLLDEHGGLWIRLTLCGV 80
gi 194303016   1 MSEPDVEGLAKLREPFPPNQIGKLPKGGITLDFLGHGYLTARFLDVDPLWTWEPFAVGDNGLPLLDEHGGLWIRLTLCGV 80
gi 206600244   1 MSEPDVEGLAKLREPFPPNQIGKLPKGGITLDFLGHGYLTARFLDVDPLWTWEPFAVGDNGLPLLDEHGGLWIRLTLCGV 80
gi 206599939   1 MSEPDVEGLAKLREPFPPNQIGKLPKGGITLDFLGHGYLTARFLDVDPLWTWEPFAVGDNGLPLLDEHGGLWIRLTLCGV 80
gi 291084914   1 MSEPDVEGLAKLREPFPPNQIGKLPKGGITLDFLGHGYLTARFLDVDPLWTWEPFAVGDNGLPLLDEHGGLWIRLTLCGV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109522145  81 TRIGYGDAGGKKGPNAVKEAIGDALRNAGMRFGAALDLWCKGDPDAPAPPDPAVAERNALLHELGDACAALTLDEKTVAA 160
gi 109392246  81 TRIGYGDAGGKKGPNAVKEAIGDALRNAGMRFGAALDLWCKGDPDAPAPPDPAVAERNALLHELGDACAALTLDEKTVAA 160
gi 157311253  81 TRIGYGDAGGKKGPNAVKEAIGDALRNAGMRFGAALDLWCKGDPDAPAPPDPAVAERNALLHELGDACAALTLDEKTVAA 160
gi 194303016  81 TRIGYGDAGGKKGPNAVKEAIGDALRNAGMRFGAALDLWCKGDPDAPAPPDPAVAERNALLHELGDACAALTLDEKTVAA 160
gi 206600244  81 TRIGYGDAGGKKGPNAVKEAIGDALRNAGMRFGAALDLWCKGDPDAPAPPDPAVAERNALLHELGDACAALTLDEKTVAA 160
gi 206599939  81 TRIGYGDAGGKKGPNAVKEAIGDALRNAGMRFGAALDLWCKGDPDAPAPPDPAVAERNALLHELGDACAALTLDEKTVAA 160
gi 291084914  81 TRIGYGDAGGKKGPNAVKEAIGDALRNAGMRFGAALDLWCKGDPDAPAPPDPAVAERNALLHELGDACAALTLDEKTVAA 160
                        170       180       190
                 ....*....|....*....|....*....|..
gi 109522145 161 QFYGKYKVTARNAKPAQLREFIDDLMENGAPA 192
gi 109392246 161 QFYGKYKVTARNAKPAQLREFIDDLMENGAPA 192
gi 157311253 161 QFYGKYKVTARNAKPQQLREFIDDLMENGAPA 192
gi 194303016 161 QFYGKYKVTARNAKPAQLREFIDDLMENGAPA 192
gi 206600244 161 QFYGKYKVTARNAKPAQLREFIDDLMENGAPA 192
gi 206599939 161 QFYGKYKVTARNAKPAQLREFIDDLMENGAPA 192
gi 291084914 161 QFYGKYKVTARNAKPAQLREFIDDLMENGAPA 192
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap