Conserved Protein Domain Family
PHA02450

?
PHA02450: PHA02450 
hypothetical protein
Statistics
?
PSSM-Id: 134010
View PSSM: PHA02450
Aligned: 5 rows
Threshold Bit Score: 92.3238
Threshold Setting Gi: 157786535
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|...
gi 109392261  1 MSGEINPEGFTRYGGDCTCGPIYTYGGHAEPGQFDPFCPDHGNPEYVASLEEA 53
gi 157786535  1 MSGDINAEGFIRYGGDCTCGAIYTYGGHAEPGSFDPFCPDHGEAAVVATGEEA 53
gi 109522160  1 MSGEINPEGFTRYGGDCTCGPIYTYGGHAEPGQFDPFCPDHGNPEYVASLEEA 53
gi 194303030  1 MSGEINPEGFTRYGGDCTCGPIYTYGGHAEPGQFDPFCPDHGNPEYVASLEEA 53
gi 194303166  1 ---MINPEGFTRYGGDCICGPIYTYNGIPEPGQFDPFCPDHGDPEYVASLELT 50
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap