Conserved Protein Domain Family
PHA02508

?
PHA02508: PHA02508 
putative minor coat protein; Provisional
Statistics
?
PSSM-Id: 107192
View PSSM: PHA02508
Aligned: 2 rows
Threshold Bit Score: 68.4118
Threshold Setting Gi: 118430719
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9626320    1 MARLLALVIGYaLSSFVLKLFTVLGVGIFTYVGLTALVDGFLNLLQPMLTGLPSYILDILAIAGVPEALSIVGSALLTRA 80
gi 118430719  1 MMPLAGFLMAL-VGPLARQLLVSLGIGLITYVGLDAAVSAALGAAKSSLAGMPAVAAAILARGGVFTGLSIIAGGITARI 79
                        90
                ....*....|...
gi 9626320   81 SINSAKAfVGVLT 93
gi 118430719 80 SMITLKR-LGKLT 91
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap