Conserved Protein Domain Family
PHA02515

?
PHA02515: PHA02515 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 107197
View PSSM: PHA02515
Aligned: 3 rows
Threshold Bit Score: 788.203
Threshold Setting Gi: 41179370
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179370   1 MSVQSTDRVAGPYPCNGLTTQFPFDFKVFNTGEVVAILSDADGVESTLTLGTDYTVALNDNQDSNPGGTLTTLATYATGY 80
gi 45580753   1 MSVQSTDRVAGPYPCNGLTTQFPFDFKVFNTGEVVAILSDADGVESTLTLGTDYTVALNDNQDSNPGGTLTTLATYATGY 80
gi 45569502   1 MSVQSTDRVAGPYPCNGLTTQFPFDFKVFNTGEVVAILSDADGVESTLTLGTDYTVALNDNQDSNPGGTLTTLATYATGY 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179370  81 KITLTSEVPNTQPETLTNQGGFYPKVIEHALDRLVIQIQQLADKLSRTVQAPISGGLSSSEILEQLAEQLPLVSAVYGHL 160
gi 45580753  81 KITLTSEVPNTQPETLTNQGGFYPKVIEHALDRLVIQIQQLADKLSRTVQAPISGGLSSSEILEQLAEQLPLVSAVYGHL 160
gi 45569502  81 KITLTSEVPNTQPETLTNQGGFYPKVIEHALDRLVIQIQQLADKLSRTVQAPISGGLSSSEILEQLAEQLPLVSAVYGHL 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179370 161 ANIDAVATNEADIDTVAASVGAVDTVAGDLGGTWAAGVSYDFGSIAVPPIGNTSPPGGNIVIVANSIGNVDTVAENIGDV 240
gi 45580753 161 ANIDAVATNEADIDTVAASVGAVDTVAGDLGGTWAAGVSYDFGSIAVPPIGNTSPPGGNIVIVANSIGNVDTVAENIGDV 240
gi 45569502 161 ANIDAVATNEADIDTVAASVGAVDTVAGDLGGTWAAGVSYDFGSIAVPPIGNTSPPGGNIVIVANSIGNVDTVAENIGDV 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179370 241 STVSTHLSSMLAVANDIDSVVSVAGDLENIDAVADNAANINTVAGANANVNTVASNILDVGTVAGNIDDVQAVAGNAANI 320
gi 45580753 241 STVSTHLSSMLAVANDIDSVVSVAGDLENIDAVADNAANINTVAGANANVNTVASNILDVGTVAGNIDDVQAVAGNAANI 320
gi 45569502 241 STVSTHLSSMLAVANDIDSVVSVAGDLENIDAVADNAANINTVAGANANVNTVASNILDVGTVAGNIDDVQAVAGNAANI 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179370 321 NVVADNADNINATAANQANINAAVGNADNINAAVANQANINAVVGNANNINAVAANEGNVNTVVDNLADVQTVAGIAADV 400
gi 45580753 321 NVVADNADNINATAANQANINAAVGNADNINAAVANQANINAVVGNANNINAVAANEGNVNTVVDNLADVQTVAGIAADV 400
gi 45569502 321 NVVADNADNINATAANQANINAAVGNADNINAAVANQANINAVVGNANNINAVAANEGNVNTVVDNLADVQTVAGIAADV 400
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179370 401 STVAENEAAVAALGNDLTGQPMVIDYGDLSPASNPAAPAGVLGAVWANAENIAAVAENIAVIIEAANNLPAILAALSGAL 480
gi 45580753 401 STVAENEAAVAALGNDLTGQPMVIDYGDLSPASNPAAPAGVLGAVWANAENIAAVAENIAVIIEAANNLPAILAALSGAL 480
gi 45569502 401 STVAENEAAVAALGNDLTGQPMVIDYGDLSPASNPAAPAGVLGAVWANAENIAAVAENIAVIIEAANNLPAILAALSGAL 480
                       490       500
                ....*....|....*....|....*...
gi 41179370 481 VPANNLSDLADPAAARANIGLADLGGIA 508
gi 45580753 481 VPANNLSDLADPAAARANIGLADLGGIA 508
gi 45569502 481 VPANNLSDLADPAAARANIGLADLGGIA 508
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap