Conserved Protein Domain Family
PHA02519

?
PHA02519: PHA02519 
plasmid partition protein SopA; Reviewed
Statistics
?
PSSM-Id: 107201
View PSSM: PHA02519
Aligned: 3 rows
Threshold Bit Score: 813.86
Threshold Setting Gi: 33770537
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33770537   1 MNLQSTLNSCIERGQTMTQAIARAQFGDDSPEARAITRRWGITEAAELVGVTPQTIRNGEDSGKLPPADMVTRGRVPQRA 80
gi 46402111   1 MSLINLLQECISRGQEMTQAIAIAQFGDDSPEARKITRRWGITEVADLIGVSPQAIRDAEKNGRLPPPDFELRGRVERRA 80
gi 9630492    1 MSLINLLKDCINRGQEMTRAIAIAQFGDDSPEARRITRRWGITEVADLIGVTPQAIRDAEKAGRLPAPDFEMRGRVERRA 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33770537  81 GYTIQQINDLRDHFGTRWKRPDGQDPVVLAIAAHKGGAYKTSTSVHTAQWLALQGLRVLLIDATDPQATASLYHGYVPDL 160
gi 46402111  81 GYTIDQISHMRNIFGNPNQRPADKNPAVLAVMSHKGGVYKTSSAVHEAQWLALQGHRVLLIEGNDPQGTASMYHGYVPDL 160
gi 9630492   81 GYTIDQISHMRSVFGNPNQRPDDKNPVVLSVMSHKGGVYKTSSAVHQAQWLALQGHRVLLVEGNDPQGTASMYHGYVPDL 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33770537 161 HIHEDETLLPYYLGERDDAMYAIKPTCWPNLDIIPSCLAIHRIESELYPLHDAEKLPVAPHMMLRAAIESVWDSYDVVVL 240
gi 46402111 161 HIHADDTLLPFYLGERDNAEYAIKPTCWPGLDIIPSCLALHRIETDLMQYHAQGKLPHPPHLMLRAAIESVWDNYDIIVI 240
gi 9630492  161 HIHADDTLLPFYLGKRDNAEYAIKPTCWPGLDIIPSCLALHRIETDLMQYHSEGKLPHPPHLMLRAAIESVWDNYDIIVI 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33770537 241 DSAPNLGIGTINVVCAADVIVVPTPAELYDYVSTLQFFTMLRDLMAGVDLGGFEPDVRVLITKFSNAVGSQSQWMDDHIR 320
gi 46402111 241 DSAPNLGTGTINVVCAADIIVVATPAELFDYSSVLQFFTMLLDLLKTVDLGGFEPVVRLLLTKYSLTTGNQSRWMEEQIR 320
gi 9630492  241 DSAPNLGTGTINVVCAADVIVVATPAELFDYASVLQFFTMLLDLLETVDLGGFEPVVRLLLTKYSLTNGNQSRWMEEQIR 320
                       330       340       350       360       370       380
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 33770537 321 DAWGSMVLKEVVRVTDEVGKGQVRMRTVFEQAANQRSTPNAWRNAVAIWEPVCAEIYNRLIKPRWEN 387
gi 46402111 321 NTWGSMVLRQVVRVTDEVGKGQIKMRTVFEQAAYQRSTLNAWRNAVSIWEPVCQEIFDDLIKPRWEE 387
gi 9630492  321 NTWGAMVLRQVVRVTDEVGKGQIKMRTVFEQAANQRSTLNAWRNAVEIWEPVCKEIFEDLIKPRWED 387
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap