Conserved Protein Domain Family
PHA03307

?
PHA03307: PHA03307 
transcriptional regulator ICP4; Provisional
Statistics
?
PSSM-Id: 223039
Aligned: 36 rows
Threshold Bit Score: 762.404
Threshold Setting Gi: 83722642
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
125745132    3 NPPDFDSLLAAFDEDVGIFPHTPATPGDpyqgvslqtpcvpvpslagqs-----------------------gtyrphss 59  
9629809      8 FAPDLYDFIESNNLDEDNLIRAASAAEEgfh------------------------------------------------- 38  
9629793      8 FAPDLYDFIESNNLDEDNLIRAASAAEEgfh------------------------------------------------- 38  
12084909    17 NSPDFASLLAALEEGGPFHQNPRTPGDPyqdvslqt-------------------------------------------- 52  
10834955     3 NPPDFYSLLEMLADNGGFSPQPPATPGDpyqdvclntpsvavpptpgrqpvpprsksparaapvagslagarapfgiega 82  
10834942     3 NPPDFYSLLEMLADNGGFSPQPPATPGDpyqdvclntpsvavpptpgrqpvpprsksparaapvagslagarapfgiega 82  
125745143    3 NPPDFDSLLAAFDEDVGIFPHTPATPGDpyqgvslqtpcvpvpslagqs-----------------------gtyrphss 59  
216905933    8 FAPDLYDFIESNDFGEDPLIRAASAAEEgft------------------------------------------------- 38  
270339501   18 PQIDLFDLIEDFTDGREEFEFLGDTNSDves------------------------------------------------- 48  
270339510   18 PQIDLFDLIEDFTDGREEFEFLGDTNSDves------------------------------------------------- 48  
9629809      8 FAPDLYDFIESNNLDEDNLIRAASAAEEgfh------------------------------------------------- 38  
9629793      8 FAPDLYDFIESNNLDEDNLIRAASAAEEgfh------------------------------------------------- 38  
12084909    17 NSPDFASLLAALEEGGPFHQNPRTPGDPyqdvslqt-------------------------------------------- 52  
10834955     3 NPPDFYSLLEMLADNGGFSPQPPATPGDpyqdvclntpsvavpptpgrqpvpprsksparaapvagslagarapfgiega 82  
10834942     3 NPPDFYSLLEMLADNGGFSPQPPATPGDpyqdvclntpsvavpptpgrqpvpprsksparaapvagslagarapfgiega 82  
125745143    3 NPPDFDSLLAAFDEDVGIFPHTPATPGDpyqgvslqtpcvpvpslagqs-----------------------gtyrphss 59  
216905933    8 FAPDLYDFIESNDFGEDPLIRAASAAEEgft------------------------------------------------- 38  
270339501   18 PQIDLFDLIEDFTDGREEFEFLGDTNSDves------------------------------------------------- 48  
270339510   18 PQIDLFDLIEDFTDGREEFEFLGDTNSDves------------------------------------------------- 48  
125745132   60 yhgqrslssgpvpAAHSPRSGRPGQHSTSNGVAAAAPPAATRAVCDTAGPTTDtssnrpggrnssngadesgesssdrsp 139 
9629809     39 -----------tpAAPDLLYGSQGMFGVDDAPLATPAVVI---------------------------------------- 67  
9629793     39 -----------tpAAPDLLYGSQGMFGVDDAPLATPAVVI---------------------------------------- 67  
12084909    53 ------pcvsllsTAVDPISGHNPQLPPISHHGTASTHDAGEDACSRFEPPDGrsespass------------------- 107 
10834955    83 vsegsdtglrsaePPDGAHQGSPGEVVSSTADIVDVCGNETAAAAPRSCSWQKtvgdlvpagsergepspmdprksndpv 162 
10834942    83 vsegsdtglrsaePPDGAHQGSPGEVVSSTADIVDVCGNETAAAAPRSCSWQKtvgdlvpagsergepspmdprksndpv 162 
125745143   60 yhgqrslssgpvpAAHSPRSGRPGQHSTSNGVAAAAPPAATRAVCDTAGPTTDtssnrpggrnssngadesgesssdrsp 139 
216905933   39 -----------qpAAPDLLYGSQGMFGVDDAPLATPAVVI---------------------------------------- 67  
270339501   49 -----------rgRPQDLLYGSQGFLVSPPGDKDEVFFDFGKTPDDVNRVGN---------------------------- 89  
270339510   49 -----------rgRPQDLLYGSQGFLVSPPGDKDEVFFDFGKTPDDVNRVGN---------------------------- 89  
9629809     39 -----------tpAAPDLLYGSQGMFGVDDAPLATPAVVI---------------------------------------- 67  
9629793     39 -----------tpAAPDLLYGSQGMFGVDDAPLATPAVVI---------------------------------------- 67  
12084909    53 ------pcvsllsTAVDPISGHNPQLPPISHHGTASTHDAGEDACSRFEPPDGrsespass------------------- 107 
10834955    83 vsegsdtglrsaePPDGAHQGSPGEVVSSTADIVDVCGNETAAAAPRSCSWQKtvgdlvpagsergepspmdprksndpv 162 
10834942    83 vsegsdtglrsaePPDGAHQGSPGEVVSSTADIVDVCGNETAAAAPRSCSWQKtvgdlvpagsergepspmdprksndpv 162 
125745143   60 yhgqrslssgpvpAAHSPRSGRPGQHSTSNGVAAAAPPAATRAVCDTAGPTTDtssnrpggrnssngadesgesssdrsp 139 
216905933   39 -----------qpAAPDLLYGSQGMFGVDDAPLATPAVVI---------------------------------------- 67  
270339501   49 -----------rgRPQDLLYGSQGFLVSPPGDKDEVFFDFGKTPDDVNRVGN---------------------------- 89  
270339510   49 -----------rgRPQDLLYGSQGFLVSPPGDKDEVFFDFGKTPDDVNRVGN---------------------------- 89  
125745132  140 syspcdsycdpdrvssyrssvdgsPESGDiesasgsggtsspplleilaadfgedtkaldpdyylradprfkayfygmde 219 
9629809     68 ------------------------PPPSP--------------------------------------------------- 72  
9629793     68 ------------------------PPPSP--------------------------------------------------- 72  
12084909   108 ----------------ppssatscAPPSPfglh----------------------------------------------- 124 
10834955   163 rcvsdapckptgactplavcvetlPPPSG--------------------------------------------------- 191 
10834942   163 rcvsdapckptgactplavcvetlPPPSG--------------------------------------------------- 191 
125745143  140 syspcdsycdpdrvssyrssvdgsPESGDiesasgsggtsspplleilaadfgedtkaldpdyylradprfkayfygmde 219 
216905933   68 ------------------------PPPSP--------------------------------------------------- 72  
270339501   90 ------------------------PTSGG--------------------------------------------------- 94  
270339510   90 ------------------------PTSGG--------------------------------------------------- 94  
9629809     68 ------------------------PPPSP--------------------------------------------------- 72  
9629793     68 ------------------------PPPSP--------------------------------------------------- 72  
12084909   108 ----------------ppssatscAPPSPfglh----------------------------------------------- 124 
10834955   163 rcvsdapckptgactplavcvetlPPPSG--------------------------------------------------- 191 
10834942   163 rcvsdapckptgactplavcvetlPPPSG--------------------------------------------------- 191 
125745143  140 syspcdsycdpdrvssyrssvdgsPESGDiesasgsggtsspplleilaadfgedtkaldpdyylradprfkayfygmde 219 
216905933   68 ------------------------PPPSP--------------------------------------------------- 72  
270339501   90 ------------------------PTSGG--------------------------------------------------- 94  
270339510   90 ------------------------PTSGG--------------------------------------------------- 94  
125745132  220 ispttsedidellvllspqsvnraserqladtaasalrapspvfwsafdsryPHLAPANQSNSDPLCPETSTASAQILHT 299 
9629809        --------------------------------------------------------------------------------     
9629793        --------------------------------------------------------------------------------     
12084909   125 -------------------------------------------------slySTISNDNEVSTVSSWHSSVDRPFSSSGS 155 
10834955   192 ----------------------------------------------------VPPPPPPEPIVNFPWTFSPLTPGPFAQH 219 
10834942   192 ----------------------------------------------------VPPPPPPEPIVNFPWTFSPLTPGPFAQH 219 
125745143  220 ispttsedidellvllspqsvnraserqladtaasalrapspvfwsafdsryPHLAPANQSNSDPLCPETSTASAQILHT 299 
216905933   73 --------------------------------------------------------------------------APEPRG 78  
270339501   95 ----------------------------------------------------------------------TKTLTSPRPT 104 
270339510   95 ----------------------------------------------------------------------TKTLTSPRPT 104 
9629809        --------------------------------------------------------------------------------     
9629793        --------------------------------------------------------------------------------     
12084909   125 -------------------------------------------------slySTISNDNEVSTVSSWHSSVDRPFSSSGS 155 
10834955   192 ----------------------------------------------------VPPPPPPEPIVNFPWTFSPLTPGPFAQH 219 
10834942   192 ----------------------------------------------------VPPPPPPEPIVNFPWTFSPLTPGPFAQH 219 
125745143  220 ispttsedidellvllspqsvnraserqladtaasalrapspvfwsafdsryPHLAPANQSNSDPLCPETSTASAQILHT 299 
216905933   73 --------------------------------------------------------------------------APEPRG 78  
270339501   95 ----------------------------------------------------------------------TKTLTSPRPT 104 
270339510   95 ----------------------------------------------------------------------TKTLTSPRPT 104 
125745132  300 NSPTPPTSTSPAPIPSPTQP---------------------------------PACLPSPA------------------- 327 
9629809     73 -APEPRGGKAKRSPARAAVP---------------------------------ASPAHNPA------------------- 99  
9629793     73 -APEPRGGKAKRSPARAAVP---------------------------------ASPAHNPA------------------- 99  
12084909   156 GSDEDDNSSSDEGPEASSPPrfldiefgrgsrrsdppyifekdagykayyyerDSPEPRPPcvediecfyeppapyqshi 235 
10834955   220 HSPTPPTPPPLSPPPPTPPP---------------------------------LSPPPPTP------------------- 247 
10834942   220 HSPTPPTPPPLSPPPPTPPP---------------------------------LSPPPPTP------------------- 247 
125745143  300 NSPTPPTSTSPAPIPSPTQP---------------------------------PACLPSPA------------------- 327 
216905933   79 GKAKRSPAAGGPPTPAAAQP---------------------------------ASPAPSPA------------------- 106 
270339501  105 RETITSGPTTKPPPPPTIHS---------------------------------AASPETPV------------------- 132 
270339510  105 RETITSGPTTKPPPPPTIHS---------------------------------AASPETPV------------------- 132 
9629809     73 -APEPRGGKAKRSPARAAVP---------------------------------ASPAHNPA------------------- 99  
9629793     73 -APEPRGGKAKRSPARAAVP---------------------------------ASPAHNPA------------------- 99  
12084909   156 GSDEDDNSSSDEGPEASSPPrfldiefgrgsrrsdppyifekdagykayyyerDSPEPRPPcvediecfyeppapyqshi 235 
10834955   220 HSPTPPTPPPLSPPPPTPPP---------------------------------LSPPPPTP------------------- 247 
10834942   220 HSPTPPTPPPLSPPPPTPPP---------------------------------LSPPPPTP------------------- 247 
125745143  300 NSPTPPTSTSPAPIPSPTQP---------------------------------PACLPSPA------------------- 327 
216905933   79 GKAKRSPAAGGPPTPAAAQP---------------------------------ASPAPSPA------------------- 106 
270339501  105 RETITSGPTTKPPPPPTIHS---------------------------------AASPETPV------------------- 132 
270339510  105 RETITSGPTTKPPPPPTIHS---------------------------------AASPETPV------------------- 132 
125745132  328 ----PISSPVQPPAllplifspitpvefiqpQSPPSPPQAPSPPAHSSSSCSPSHLAPSPLSSSPLSSPPQLSPAPVSP- 402 
9629809    100 ----PGLAEMLKMV-----------------HSSAATG------------AGRRDTGSSGGGAYNQGTGSDTETCPGSP- 145 
9629793    100 ----PGLAEMLKMV-----------------HSSAATG------------AGRRDTGSSGGGAYNQGTGSDTETCPGSP- 145 
12084909   236 yaarNAVSEALRASpdsywfrfdqhhgtqaaGGESPNSCTEMIDTPLPNPPVESPTPEPLESMVFSPISPASVHSVSAPl 315 
10834955   248 ----PPLSPPPPTP-----------------PPHTPPPHGSPPPTPLPSTSPPSTQTSSPSASLPLDSPPASTPPPPTP- 305 
10834942   248 ----PPLSPPPPTP-----------------PPHTPPPHGSPPPTPLPSTSPPSTQTSSPSASLPLDSPPASTPPPPTP- 305 
125745143  328 ----PISSPVQPPAllplifspitpvefiqpQSPPSPPQAPSPPAHSSSSCSPSHLAPSPLSSSPLSSPPQLSPAPVSP- 402 
216905933  107 ----PGLAAMLKMV-------------------------HSSVAPGNGRRATGSSSSGGGDAADPVALDSDTETCPGSP- 156 
270339501  133 ----PDIIEMLRRV-------------------------QEDLGVSESHGRSTSDTETCSHPSNALSITDSSAHSPSSV- 182 
270339510  133 ----PDIIEMLRRV-------------------------QEDLGVSESHGRSTSDTETCSHPSNALSITDSSAHSPSSV- 182 
9629809    100 ----PGLAEMLKMV-----------------HSSAATG------------AGRRDTGSSGGGAYNQGTGSDTETCPGSP- 145 
9629793    100 ----PGLAEMLKMV-----------------HSSAATG------------AGRRDTGSSGGGAYNQGTGSDTETCPGSP- 145 
12084909   236 yaarNAVSEALRASpdsywfrfdqhhgtqaaGGESPNSCTEMIDTPLPNPPVESPTPEPLESMVFSPISPASVHSVSAPl 315 
10834955   248 ----PPLSPPPPTP-----------------PPHTPPPHGSPPPTPLPSTSPPSTQTSSPSASLPLDSPPASTPPPPTP- 305 
10834942   248 ----PPLSPPPPTP-----------------PPHTPPPHGSPPPTPLPSTSPPSTQTSSPSASLPLDSPPASTPPPPTP- 305 
125745143  328 ----PISSPVQPPAllplifspitpvefiqpQSPPSPPQAPSPPAHSSSSCSPSHLAPSPLSSSPLSSPPQLSPAPVSP- 402 
216905933  107 ----PGLAAMLKMV-------------------------HSSVAPGNGRRATGSSSSGGGDAADPVALDSDTETCPGSP- 156 
270339501  133 ----PDIIEMLRRV-------------------------QEDLGVSESHGRSTSDTETCSHPSNALSITDSSAHSPSSV- 182 
270339510  133 ----PDIIEMLRRV-------------------------QEDLGVSESHGRSTSDTETCSHPSNALSITDSSAHSPSSV- 182 
125745132  403 PSSPPPLSPGELAPSPDPPRHSISSQPQSCPVPSLGRSADFRREVAAprvrgagfryvyrlstsvaipsppreevelikh 482 
9629809    146 GAEFP---PSASPEGRPAPRGRSISISSSSSSSSSTEDQADGAGASS--------------------------------- 189 
9629793    146 GAEFP---PSASPEGRPAPRGRSISISSSSSSSSSTEDQADGAGASS--------------------------------- 189 
12084909   316 SSPVPISTQPTRLPPTSHARNSPFRHGVDDAQPRSGRMSEFSPSQTAgasfvyvrqlamsvealtppheqlamitqlpgs 395 
10834955   306 LHDRPLSPDPPALSASCQRPSPPLSPSAPRLAPAPLRSDRVPARRKSsvsegggprtrgagfqyvcrlsasaripsppre 385 
10834942   306 LHDRPLSPDPPALSASCQRPSPPLSPSAPRLAPAPLRSDRVPARRKSsvsegggprtrgagfqyvcrlsasaripsppre 385 
125745143  403 PSSPPPLSPGELAPSPDPPRHSISSQPQSCPVPSLGRSADFRREVAAprvrgagfryvyrlstsvaipsppreevelikh 482 
216905933  157 QPEFPPSASPGGGSPAPRVRSISISSSSSSSSSMDADDQADGAGASS--------------------------------- 203 
270339501  183 GVCDVTECDSLGARDYSRGRRSPISVGSMSPGPRRGRRSRSGSSSSS--------------------------------- 229 
270339510  183 GVCDVTECDSLGARDYSRGRRSPISVGSMSPGPRRGRRSRSGSSSSS--------------------------------- 229 
9629809    146 GAEFP---PSASPEGRPAPRGRSISISSSSSSSSSTEDQADGAGASS--------------------------------- 189 
9629793    146 GAEFP---PSASPEGRPAPRGRSISISSSSSSSSSTEDQADGAGASS--------------------------------- 189 
12084909   316 SSPVPISTQPTRLPPTSHARNSPFRHGVDDAQPRSGRMSEFSPSQTAgasfvyvrqlamsvealtppheqlamitqlpgs 395 
10834955   306 LHDRPLSPDPPALSASCQRPSPPLSPSAPRLAPAPLRSDRVPARRKSsvsegggprtrgagfqyvcrlsasaripsppre 385 
10834942   306 LHDRPLSPDPPALSASCQRPSPPLSPSAPRLAPAPLRSDRVPARRKSsvsegggprtrgagfqyvcrlsasaripsppre 385 
125745143  403 PSSPPPLSPGELAPSPDPPRHSISSQPQSCPVPSLGRSADFRREVAAprvrgagfryvyrlstsvaipsppreevelikh 482 
216905933  157 QPEFPPSASPGGGSPAPRVRSISISSSSSSSSSMDADDQADGAGASS--------------------------------- 203 
270339501  183 GVCDVTECDSLGARDYSRGRRSPISVGSMSPGPRRGRRSRSGSSSSS--------------------------------- 229 
270339510  183 GVCDVTECDSLGARDYSRGRRSPISVGSMSPGPRRGRRSRSGSSSSS--------------------------------- 229 
125745132  483 lpgsyaklwlhdpdgfsplpeelkragrqnmrsflltlpdthrcsaywdcla---teallreilppphtsspqkcpriie 559 
9629809        --------------------------------------------------------------------------------     
9629793        --------------------------------------------------------------------------------     
12084909   396 haqlwsklleageevraysdlvragqhdvcaflltlsdikrcpsfwd--------------qlaaeavireishqsrgkg 461 
10834955   386 elelvarqpgshamlwragardgatepssgddpkvfllalsdarrcpsywdrlareavlreilptprgsplrtspgsiel 465 
10834942   386 elelvarqpgshamlwragardgatepssgddpkvfllalsdarrcpsywdrlareavlreilptprgsplrtspgsiel 465 
125745143  483 lpgsyaklwlhdpdgfsplpeelkragrqnmrsflltlpdthrcsaywdcla---teallreilppphtsspqkcpriie 559 
216905933      --------------------------------------------------------------------------------     
270339501      --------------------------------------------------------------------------------     
270339510      --------------------------------------------------------------------------------     
9629809        --------------------------------------------------------------------------------     
9629793        --------------------------------------------------------------------------------     
12084909   396 haqlwsklleageevraysdlvragqhdvcaflltlsdikrcpsfwd--------------qlaaeavireishqsrgkg 461 
10834955   386 elelvarqpgshamlwragardgatepssgddpkvfllalsdarrcpsywdrlareavlreilptprgsplrtspgsiel 465 
10834942   386 elelvarqpgshamlwragardgatepssgddpkvfllalsdarrcpsywdrlareavlreilptprgsplrtspgsiel 465 
125745143  483 lpgsyaklwlhdpdgfsplpeelkragrqnmrsflltlpdthrcsaywdcla---teallreilppphtsspqkcpriie 559 
216905933      --------------------------------------------------------------------------------     
270339501      --------------------------------------------------------------------------------     
270339510      --------------------------------------------------------------------------------     
125745132  560 lprepplldgdykpfdwdvecnyapplpdfpepicelskdwvgckiwlfshcsrlvlsvlDDALHSEshenvlgSRGCGW 639 
9629809    190 ------------------------------------------------------------SSSSSSE-------DSDSDD 202 
9629793    190 ------------------------------------------------------------SSSSSSE-------DSDSDD 202 
12084909   462 lqkeapltddnyipfdyqggastssnssppfsqhghkqvvtwpsckiwlftkgsravleaMDNAAYQelesglgSLDCGW 541 
10834955   466 preaplldsdyrpfewrcakgrplpqepvfpcppnelgndwaackmwlfsrcarlvlstlDDMSPSEdgesvleSQGCGW 545 
10834942   466 preaplldsdyrpfewrcakgrplpqepvfpcppnelgndwaackmwlfsrcarlvlstlDDMSPSEdgesvleSQGCGW 545 
125745143  560 lprepplldgdykpfdwdvecnyapplpdfpepicelskdwvgckiwlfshcsrlvlsvlDDALHSEshenvlgSRGCGW 639 
216905933  204 ------------------------------------------------------------SSSSSSD-------DSDSDE 216 
270339501  230 ------------------------------------------------------------SSSSSSG------------- 236 
270339510  230 ------------------------------------------------------------SSSSSSG------------- 236 
9629809    190 ------------------------------------------------------------SSSSSSE-------DSDSDD 202 
9629793    190 ------------------------------------------------------------SSSSSSE-------DSDSDD 202 
12084909   462 lqkeapltddnyipfdyqggastssnssppfsqhghkqvvtwpsckiwlftkgsravleaMDNAAYQelesglgSLDCGW 541 
10834955   466 preaplldsdyrpfewrcakgrplpqepvfpcppnelgndwaackmwlfsrcarlvlstlDDMSPSEdgesvleSQGCGW 545 
10834942   466 preaplldsdyrpfewrcakgrplpqepvfpcppnelgndwaackmwlfsrcarlvlstlDDMSPSEdgesvleSQGCGW 545 
125745143  560 lprepplldgdykpfdwdvecnyapplpdfpepicelskdwvgckiwlfshcsrlvlsvlDDALHSEshenvlgSRGCGW 639 
216905933  204 ------------------------------------------------------------SSSSSSD-------DSDSDE 216 
270339501  230 ------------------------------------------------------------SSSSSSG------------- 236 
270339510  230 ------------------------------------------------------------SSSSSSG------------- 236 
125745132  640 GPRSECPVPPPGMVTLPSCVWEAAArlptpalqipkyayiisaflrflglrvtpefvfkvprlsyrlldrlrclrrvqym 719 
9629809    203 GGEEKTPRPHPSPSAAKTQPATGSpgqisgdr------------------------------------------------ 234 
9629793    203 GGEEKTPRPHPSPSAAKTQPATGSpgqisgdr------------------------------------------------ 234 
12084909   542 GPENECPLPRPGTIDLPTSIMQAIEqlcptsspipkyafalsallrflglrippgvvsaiprlsyrcldclrcvrrmqym 621 
10834955   546 GPQNECPLPLPAPIVLPTRIWEAVTrlprpaprtptyayilsallrflglqvtpdfvskvprlsyrwldrlrcvrrvqym 625 
10834942   546 GPQNECPLPLPAPIVLPTRIWEAVTrlprpaprtptyayilsallrflglqvtpdfvskvprlsyrwldrlrcvrrvqym 625 
125745143  640 GPRSECPVPPPGMVTLPSCVWEAAArlptpalqipkyayiisaflrflglrvtpefvfkvprlsyrlldrlrclrrvqym 719 
216905933  217 GGEEETPRPRHSPDAAKTPSAAGSPgpssg-------------------------------------------------- 246 
270339501      --------------------------------------------------------------------------------     
270339510      --------------------------------------------------------------------------------     
9629809    203 GGEEKTPRPHPSPSAAKTQPATGSpgqisgdr------------------------------------------------ 234 
9629793    203 GGEEKTPRPHPSPSAAKTQPATGSpgqisgdr------------------------------------------------ 234 
12084909   542 GPENECPLPRPGTIDLPTSIMQAIEqlcptsspipkyafalsallrflglrippgvvsaiprlsyrcldclrcvrrmqym 621 
10834955   546 GPQNECPLPLPAPIVLPTRIWEAVTrlprpaprtptyayilsallrflglqvtpdfvskvprlsyrwldrlrcvrrvqym 625 
10834942   546 GPQNECPLPLPAPIVLPTRIWEAVTrlprpaprtptyayilsallrflglqvtpdfvskvprlsyrwldrlrcvrrvqym 625 
125745143  640 GPRSECPVPPPGMVTLPSCVWEAAArlptpalqipkyayiisaflrflglrvtpefvfkvprlsyrlldrlrclrrvqym 719 
216905933  217 GGEEETPRPRHSPDAAKTPSAAGSPgpssg-------------------------------------------------- 246 
270339501      --------------------------------------------------------------------------------     
270339510      --------------------------------------------------------------------------------     
125745132  720 ayiltqdfsyqlqaaqglpcfpacapppgagtpldedwygipatrcptipdrlrhcgqfysdnycpvlteitwvdgrdgs 799 
9629809        --------------------------------------------------------------------------------     
9629793        --------------------------------------------------------------------------------     
12084909   622 chvltrdfssqlqsardipcfpacapppgvgtpldedwngipvgdspansaegeqcggfyhnnnaphlssitwiegkrgs 701 
10834955   626 ahvltrdfsyqlqaarglpcfpacapppgagtpldedwngtppsesprgldcsrrrggfyasnfcplleeirwvegregs 705 
10834942   626 ahvltrdfsyqlqaarglpcfpacapppgagtpldedwngtppsesprgldcsrrrggfyasnfcplleeirwvegregs 705 
125745143  720 ayiltqdfsyqlqaaqglpcfpacapppgagtpldedwygipatrcptipdrlrhcgqfysdnycpvlteitwvdgrdgs 799 
216905933      --------------------------------------------------------------------------------     
270339501      --------------------------------------------------------------------------------     
270339510      --------------------------------------------------------------------------------     
9629809        --------------------------------------------------------------------------------     
9629793        --------------------------------------------------------------------------------     
12084909   622 chvltrdfssqlqsardipcfpacapppgvgtpldedwngipvgdspansaegeqcggfyhnnnaphlssitwiegkrgs 701 
10834955   626 ahvltrdfsyqlqaarglpcfpacapppgagtpldedwngtppsesprgldcsrrrggfyasnfcplleeirwvegregs 705 
10834942   626 ahvltrdfsyqlqaarglpcfpacapppgagtpldedwngtppsesprgldcsrrrggfyasnfcplleeirwvegregs 705 
125745143  720 ayiltqdfsyqlqaaqglpcfpacapppgagtpldedwygipatrcptipdrlrhcgqfysdnycpvlteitwvdgrdgs 799 
216905933      --------------------------------------------------------------------------------     
270339501      --------------------------------------------------------------------------------     
270339510      --------------------------------------------------------------------------------     
125745132  800 tnpwtglawkdfkclhyr-ylfynvrkgfvmapenyltensvipgcevtfempqpsttlppalsaairearvelrnrnni 878 
9629809        --------------------------------------------------------------------------------     
9629793        --------------------------------------------------------------------------------     
12084909   702 ispwdgrtwkdfkklhyrylfyqvrkglvmapghflpagsarpgvelpyeipvpeetippvlsaavheagcalqnikdhc 781 
10834955   706 pnpwtgltwndfkmlh----yrclffkvrrglllapddyivgpdvrpgfevpfemppppatalppalsaavresklalrn 781 
10834942   706 pnpwtgltwndfkmlh----yrclffkvrrglllapddyivgpdvrpgfevpfemppppatalppalsaavresklalrn 781 
125745143  800 tnpwtglawkdfkclhyr-ylfynvrkgfvmapenyltensvipgcevtfempqpsttlppalsaairearvelrnrnni 878 
216905933      --------------------------------------------------------------------------------     
270339501      --------------------------------------------------------------------------------     
270339510      --------------------------------------------------------------------------------     
9629809        --------------------------------------------------------------------------------     
9629793        --------------------------------------------------------------------------------     
12084909   702 ispwdgrtwkdfkklhyrylfyqvrkglvmapghflpagsarpgvelpyeipvpeetippvlsaavheagcalqnikdhc 781 
10834955   706 pnpwtgltwndfkmlh----yrclffkvrrglllapddyivgpdvrpgfevpfemppppatalppalsaavresklalrn 781 
10834942   706 pnpwtgltwndfkmlh----yrclffkvrrglllapddyivgpdvrpgfevpfemppppatalppalsaavresklalrn 781 
125745143  800 tnpwtglawkdfkclhyr-ylfynvrkgfvmapenyltensvipgcevtfempqpsttlppalsaairearvelrnrnni 878 
216905933      --------------------------------------------------------------------------------     
270339501      --------------------------------------------------------------------------------     
270339510      --------------------------------------------------------------------------------     
125745132  879 qtgdgsesgehrdskvsyafmvqqlaiamvelgfpaygpaiekrvrplykalcdwraavtlaarrrfqqlrcnanmdddg 958 
9629809        --------------------------------------------------------------------------------     
9629793        --------------------------------------------------------------------------------     
12084909   782 edilqggsefeetadnangfmvqqlamamlelgfpaygpaiekrirplyaaiekwravieaasrrcfedmrndpemedcd 861 
10834955   782 gnpepggtphgsrparaygfmvqqlavamvelgfpacgpaiekrvrplykaildwraavtaaalrrfrhlrqpsgarddg 861 
10834942   782 gnpepggtphgsrparaygfmvqqlavamvelgfpacgpaiekrvrplykaildwraavtaaalrrfrhlrqpsgarddg 861 
125745143  879 qtgdgsesgehrdskvsyafmvqqlaiamvelgfpaygpaiekrvrplykalcdwraavtlaarrrfqqlrcnanmdddg 958 
216905933      --------------------------------------------------------------------------------     
270339501      --------------------------------------------------------------------------------     
270339510      --------------------------------------------------------------------------------     
9629809        --------------------------------------------------------------------------------     
9629793        --------------------------------------------------------------------------------     
12084909   782 edilqggsefeetadnangfmvqqlamamlelgfpaygpaiekrirplyaaiekwravieaasrrcfedmrndpemedcd 861 
10834955   782 gnpepggtphgsrparaygfmvqqlavamvelgfpacgpaiekrvrplykaildwraavtaaalrrfrhlrqpsgarddg 861 
10834942   782 gnpepggtphgsrparaygfmvqqlavamvelgfpacgpaiekrvrplykaildwraavtaaalrrfrhlrqpsgarddg 861 
125745143  879 qtgdgsesgehrdskvsyafmvqqlaiamvelgfpaygpaiekrvrplykalcdwraavtlaarrrfqqlrcnanmdddg 958 
216905933      --------------------------------------------------------------------------------     
270339501      --------------------------------------------------------------------------------     
270339510      --------------------------------------------------------------------------------     
125745132  959 qpmfpplpvpdWNNPSTDwrpspprsgpkkdfcgdlpapltsgprlttpssgrmselpHTTSSPRSSPRPRGPETSPSNE 1038
9629809    235 ----iapgsytPKSGRSE----------------------------------------KGHQSPVGAFAASTGAPTPSNP 270 
9629793    235 ----iapgsytPKSGRSE----------------------------------------KGHQSPVGAFAASTGAPTPSNP 270 
12084909   862 tpmfpalpkpdWILSPAT----------------------------------------PLPAENSGGINGSGGSPSSPHS 901 
10834955   862 apmfpplpvpdWNGPSPR----------------------------------------PGLVSSPTGTQERYRRVQPGSG 901 
10834942   862 apmfpplpvpdWNGPSPR----------------------------------------PGLVSSPTGTQERYRRVQPGSG 901 
125745143  959 qpmfpplpvpdWNNPSTDwrpspprsgpkkdfcgdlpapltsgprlttpssgrmselpHTTSSPRSSPRPRGPETSPSNE 1038
216905933  247 -------gnrpAAGAATP----------------------------------------KSCRSGAASPGAPAPAPAPSRP 279 
270339501  237 -----------SSSTGSR----------------------------------------SSSSSSSSTSRSPSPPAPPNRE 265 
270339510  237 -----------SSSTGSR----------------------------------------SSSSSSSSTSRSPSPPAPPNRE 265 
9629809    235 ----iapgsytPKSGRSE----------------------------------------KGHQSPVGAFAASTGAPTPSNP 270 
9629793    235 ----iapgsytPKSGRSE----------------------------------------KGHQSPVGAFAASTGAPTPSNP 270 
12084909   862 tpmfpalpkpdWILSPAT----------------------------------------PLPAENSGGINGSGGSPSSPHS 901 
10834955   862 apmfpplpvpdWNGPSPR----------------------------------------PGLVSSPTGTQERYRRVQPGSG 901 
10834942   862 apmfpplpvpdWNGPSPR----------------------------------------PGLVSSPTGTQERYRRVQPGSG 901 
125745143  959 qpmfpplpvpdWNNPSTDwrpspprsgpkkdfcgdlpapltsgprlttpssgrmselpHTTSSPRSSPRPRGPETSPSNE 1038
216905933  247 -------gnrpAAGAATP----------------------------------------KSCRSGAASPGAPAPAPAPSRP 279 
270339501  237 -----------SSSTGSR----------------------------------------SSSSSSSSTSRSPSPPAPPNRE 265 
270339510  237 -----------SSSTGSR----------------------------------------SSSSSSSSTSRSPSPPAPPNRE 265 
125745132 1039 HiiiSpprnPPSNTTHRNVGHVSRSPSSSSSSSSSSSPSSSSLIVPSSPSSSRSPSPSPPRPRADCSSRPRRGRGs---N 1115
9629809    271 G--------GPLAPGARILEYLEGVRDANLAKTLE---KPDPRMSPPGQSPHRAPKDQRPKSALAGASKRKRCHP----R 335 
9629793    271 G--------GPLAPGARILEYLEGVRDANLAKTLE---KPDPRMSPPGQSPHRAPKDQRPKSALAGASKRKRCHP----R 335 
12084909   902 G---GerydGYCDNRPTHSRNESPPHPSGLEKPSSSGESSRQCAFHISPPCSPSPRRARGRPVRRTRPPRTSSTSsasfS 978 
10834955   902 S---D----GSHTTAPPAVLKQALQQEVGTPATRASHPLPRPPPASYPSLGCRSRSSSSSSASSSSSSSSSAPSSse-qS 973 
10834942   902 S---D----GSHTTAPPAVLKQALQQEVGTPATRASHPLPRPPPASYPSLGCRSRSSSSSSASSSSSSSSSAPSSse-qS 973 
125745143 1039 HiiiSpprnPPSNTTHRNVGHVSRSPSSSSSSSSSSSPSSSSLIVPSSPSSSRSPSPSPPRPRADCSSRPRRGRGs---N 1115
216905933  280 G---V----GLLPPGARILEYLEGVREANLAKTLERPEPPAGMASPPGRSPQRLPKDQRPKSALAGASKRKRANP----- 347 
270339501  266 L---K----PGTPSPPRPAGEGSPITNDVIASITPQSNVVGSASTTPGATLTDGATLTDGPGDTTPKRRRRRGPL----- 333 
270339510  266 L---K----PGTPSPPRPAGEGSPITNDVIASITPQSNVVGSASTTPGATLTDGATLTDGPGDTTPKRRRRRGPL----- 333 
9629809    271 G--------GPLAPGARILEYLEGVRDANLAKTLE---KPDPRMSPPGQSPHRAPKDQRPKSALAGASKRKRCHP----R 335 
9629793    271 G--------GPLAPGARILEYLEGVRDANLAKTLE---KPDPRMSPPGQSPHRAPKDQRPKSALAGASKRKRCHP----R 335 
12084909   902 G---GerydGYCDNRPTHSRNESPPHPSGLEKPSSSGESSRQCAFHISPPCSPSPRRARGRPVRRTRPPRTSSTSsasfS 978 
10834955   902 S---D----GSHTTAPPAVLKQALQQEVGTPATRASHPLPRPPPASYPSLGCRSRSSSSSSASSSSSSSSSAPSSse-qS 973 
10834942   902 S---D----GSHTTAPPAVLKQALQQEVGTPATRASHPLPRPPPASYPSLGCRSRSSSSSSASSSSSSSSSAPSSse-qS 973 
125745143 1039 HiiiSpprnPPSNTTHRNVGHVSRSPSSSSSSSSSSSPSSSSLIVPSSPSSSRSPSPSPPRPRADCSSRPRRGRGs---N 1115
216905933  280 G---V----GLLPPGARILEYLEGVREANLAKTLERPEPPAGMASPPGRSPQRLPKDQRPKSALAGASKRKRANP----- 347 
270339501  266 L---K----PGTPSPPRPAGEGSPITNDVIASITPQSNVVGSASTTPGATLTDGATLTDGPGDTTPKRRRRRGPL----- 333 
270339510  266 L---K----PGTPSPPRPAGEGSPITNDVIASITPQSNVVGSASTTPGATLTDGATLTDGPGDTTPKRRRRRGPL----- 333 
125745132 1116 RGGRSGPQSKGRKTSPRTRKLEDEDYLPQETANRRGGgrprgrppksgravq------------------rndiqvtsss 1177
9629809    336 PIPQTAATTGAEEALPGCAWDLLDMNCSSQAPGLGTCqr----------------------------------------- 374 
9629793    336 PIPQTAATTGAEEALPGCAWDLLDMNCSSQAPGLGTCqr----------------------------------------- 374 
12084909   979 RSPSATSSTSSSSSSSSSSSSRSSSATRSSSPSVSPSsrssssgtsdssatsgserrh