Conserved Protein Domain Family
rnpA

?
PRK00038: rnpA 
ribonuclease P; Reviewed
Links
?
Statistics
?
PSSM-Id: 134052
View PSSM: PRK00038
Aligned: 5 rows
Threshold Bit Score: 152.952
Threshold Setting Gi: 33603965
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33603965    1 MPRATLPAEARLHRPSEFAAALKGRRLARGAFFIVSASPCAPADDQPARARLGLVIAKRFAARAVTRNTLKRVIREAFRA 80
gi 33598886    1 MPRATLPAEARLHRPSEFAAALKGRRLARGAFFIVSASPCAPADDQPARARLGLVIAKRFAARAVTRNTLKRVIREAFRA 80
gi 33591702    1 MPRATLPAEARLHRPSEFAAALKGRRLARGAFFIVSASPCAPADDQPARARLGLVIAKRFAARAVTRNTLKRVIREAFRA 80
gi 187479883   1 MSCATLPAEARLHRPSEFTAALKGRRLARGALFIVSAAPATSA---PACARLGLVIAKRYAALATTRNAIKRVLREAFRH 77
gi 163859334   1 MPRATLPPEARLHRPSEFAAALKGRRLARGAFFILSAAPSSPPPGQAAQARLGMVIAKRYAAHASTRNALKRVIREAFRH 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 33603965   81 RRLALPAQDYVVRLHSKLTPASLTALKRSARAEVDAHFTRIAR 123
gi 33598886   81 RRLALPAQDYVVRLHSKLTPASLTALKRSARAEVDAHFTRIAR 123
gi 33591702   81 RRLALPAQDYVVRLHSKLTPASLTALKRSARAEVDAHFTRIAR 123
gi 187479883  78 RRQALPAQDYVIRLHSKVGPLSLTALKRAARTEADAHFGRIAR 120
gi 163859334  81 CRLELPPQDYVLRLHSKPAPATLTSLKRLARAEVDAHFARVRP 123
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap