Conserved Protein Domain Family
ppnK

?
PRK00561: ppnK 
inorganic polyphosphate/ATP-NAD kinase; Provisional
Statistics
?
PSSM-Id: 100598
View PSSM: PRK00561
Aligned: 3 rows
Threshold Bit Score: 417.355
Threshold Setting Gi: 31544749
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
12044980   1 MKYKIFASTTPQTEPVLNKLRAVLKTWQAVENG---YEYVFVLGGDGFFVSTLANYNCDSCKVVGINTGHIGFYTSFNGD 77 
13508006   1 MKYKIFASTTPQTEPVLQKLKQVLKGCEAVEKG---FDYLFVLGGDGFFVSTVANYNCHNCRVVGINTGHLGFYTSFNEK 77 
31544749  15 KTYYLISSLAPKSESLKPLIKKELNKKLVEVDDptvADYLFINGGDGTFIKNAIKYDRAGLKIIGINGGSLGFYTTFNET 94 
12044980  78 DLDENFISKLTSFEFKKINLLEVKTKNHSFLVLNELAVYTNTAYPINIFIDDNHWESYRGSGLLIGPRTGSTALAKSAKG 157
13508006  78 DLDDNFLQKLQQCHFQRISLLEVSVNGQQHLVLNELAVYTNTAYPINIFIDGEAWEFYRGSGLLIGPRTGSTALAKSAKG 157
31544749  95 NIDQ-IANNLDQLKYTQLDFIRLQIDDQIHHALNEFNINSTTAYGYDIFIDNEFYQKFRGTGLLISTTTGSTGINKSANG 173
12044980 158 AVIFPNVDVVQIIELNPLLHPNQITIQSPIILPMQTKVEFRIKKAF-KAEQFPNFYADGIKLDLKNEDTSISFQLVLSRS 236
13508006 158 AVIFPGIDVLQIIEMNPLLHPNQVTIQSPIILPKETQVEFVVKKAF-NPQQFPTFYCDGRKLELPNADTTLALKLVQSTP 236
31544749 174 AILFPRIKAIQMVELYPLLHSSFTTIQSPIILPIDTKIRIEIKENYcDHDACPRIVADGAVIRQGLSSTTIEISATRSQA 253
12044980 237 MFHASLKTKDFIDKLKSTFIKQS 259
13508006 237 MFNISLKTQDFINKLKSTFIKQS 259
31544749 254 DYVATTDLRSYIQRLQKTFIY-- 274
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap