Conserved Protein Domain Family
lspA

?
PRK00573: lspA 
signal peptidase II; Provisional
Statistics
?
PSSM-Id: 100605
View PSSM: PRK00573
Aligned: 2 rows
Threshold Bit Score: 264.47
Threshold Setting Gi: 12045062
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13508032   1 MAKAPTFFSKLLKQILFANRKPFLYYKLALILFVGFVILFQVFMLRAALNGEkgingANGTDVARSSFISIYVIGNKGVG 80
gi 12045062   2 KLRKTKFFSQLKHQVLTANQKPFLFYKLTMIGFVGFIILLQVFILRNALNGE-----MDNTMVANSGFINIYVIRNKGVG 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13508032  81 FSLLADQPGLVYFLQGFLSFIALFFLVFSTSYNYIFWITTLAFGSLGNFFDRLTSGSGEVLDYFVFSGGNSVFNLADCCI 160
gi 12045062  77 FSLLQNQTGLVYFLQGLLSVIALVFLVFMVKYSYIFWITTLAFGSLGNFFDRLTSANDSVLDYFIFQNGSSVFNFADCCI 156
                       170       180
                ....*....|....*....|....
gi 13508032 161 TFSFIGLFLSFLIQFFKEMKQTKS 184
gi 12045062 157 TFGFIGLFFCFLIQMFKEFKHSKN 180
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap